Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075B0U6

Protein Details
Accession A0A075B0U6   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
180-199YSTPLPKRKCREMNKLQENFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, mito_nucl 12.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013897  DUF1769  
Pfam View protein in Pfam  
PF08588  DUF1769  
Amino Acid Sequences MTMDLSKKLYVKGNLYSGKKEESKGKLLRVNDEKHPLFVENDYFVGHLVMRIKDFDGICPFEQSSSWRNSLYNVYDAPITTCSYFEGKKRLVSLQGRFLNPECTEDVIFGVFFDNPLKLPAMSSIGIAIAKYIDPTMIVNLDADKPHAFSPLVSAMNILAVQNESSLVCNGLSSEPGGNYSTPLPKRKCREMNKLQENFLDQLNINYSESILNKPQKASLSHSIQKYLRKIADDQSNVPANIRRRREYFQDPENRKRHYFDPSKIYSMEFYSQYADLNAYKLNLGLSFDLFPIIGNQPIRYCAKSRDGQRTFFSIEIGHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.53
3 0.55
4 0.5
5 0.52
6 0.5
7 0.48
8 0.49
9 0.47
10 0.53
11 0.54
12 0.58
13 0.56
14 0.56
15 0.62
16 0.61
17 0.6
18 0.57
19 0.61
20 0.55
21 0.51
22 0.5
23 0.42
24 0.35
25 0.33
26 0.29
27 0.21
28 0.2
29 0.19
30 0.17
31 0.15
32 0.14
33 0.11
34 0.1
35 0.13
36 0.14
37 0.14
38 0.15
39 0.16
40 0.2
41 0.2
42 0.22
43 0.23
44 0.25
45 0.25
46 0.27
47 0.26
48 0.22
49 0.22
50 0.22
51 0.23
52 0.24
53 0.25
54 0.24
55 0.24
56 0.26
57 0.3
58 0.29
59 0.27
60 0.22
61 0.21
62 0.21
63 0.2
64 0.2
65 0.16
66 0.14
67 0.12
68 0.11
69 0.12
70 0.15
71 0.17
72 0.19
73 0.25
74 0.25
75 0.28
76 0.3
77 0.31
78 0.36
79 0.41
80 0.41
81 0.43
82 0.46
83 0.44
84 0.44
85 0.43
86 0.4
87 0.33
88 0.31
89 0.23
90 0.19
91 0.19
92 0.17
93 0.16
94 0.11
95 0.1
96 0.08
97 0.08
98 0.05
99 0.06
100 0.06
101 0.06
102 0.06
103 0.07
104 0.08
105 0.07
106 0.08
107 0.08
108 0.1
109 0.1
110 0.1
111 0.09
112 0.09
113 0.09
114 0.08
115 0.07
116 0.05
117 0.04
118 0.05
119 0.04
120 0.04
121 0.04
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.06
128 0.07
129 0.07
130 0.08
131 0.08
132 0.09
133 0.09
134 0.1
135 0.09
136 0.08
137 0.11
138 0.14
139 0.14
140 0.13
141 0.12
142 0.11
143 0.11
144 0.11
145 0.08
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.05
154 0.05
155 0.05
156 0.04
157 0.05
158 0.05
159 0.05
160 0.05
161 0.06
162 0.05
163 0.07
164 0.08
165 0.07
166 0.08
167 0.1
168 0.16
169 0.19
170 0.27
171 0.3
172 0.37
173 0.43
174 0.52
175 0.6
176 0.63
177 0.7
178 0.72
179 0.78
180 0.82
181 0.79
182 0.71
183 0.62
184 0.56
185 0.46
186 0.36
187 0.26
188 0.16
189 0.13
190 0.14
191 0.14
192 0.12
193 0.11
194 0.11
195 0.11
196 0.12
197 0.14
198 0.18
199 0.22
200 0.23
201 0.24
202 0.26
203 0.28
204 0.29
205 0.33
206 0.35
207 0.38
208 0.42
209 0.42
210 0.45
211 0.46
212 0.49
213 0.46
214 0.45
215 0.39
216 0.36
217 0.38
218 0.39
219 0.44
220 0.41
221 0.4
222 0.39
223 0.4
224 0.38
225 0.36
226 0.35
227 0.34
228 0.39
229 0.43
230 0.43
231 0.44
232 0.48
233 0.55
234 0.59
235 0.58
236 0.6
237 0.64
238 0.67
239 0.72
240 0.75
241 0.73
242 0.66
243 0.63
244 0.57
245 0.57
246 0.58
247 0.54
248 0.56
249 0.56
250 0.57
251 0.53
252 0.51
253 0.42
254 0.37
255 0.33
256 0.25
257 0.21
258 0.2
259 0.2
260 0.19
261 0.18
262 0.16
263 0.13
264 0.14
265 0.14
266 0.12
267 0.12
268 0.11
269 0.12
270 0.1
271 0.12
272 0.11
273 0.12
274 0.13
275 0.12
276 0.12
277 0.11
278 0.11
279 0.12
280 0.13
281 0.15
282 0.16
283 0.17
284 0.18
285 0.23
286 0.27
287 0.27
288 0.29
289 0.31
290 0.39
291 0.44
292 0.52
293 0.58
294 0.59
295 0.61
296 0.62
297 0.61
298 0.56
299 0.49
300 0.42