Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AST4

Protein Details
Accession A0A075AST4    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
110-140APKLSKKQIESLKKQKKQKKMEKLKEWLYNDHydrophilic
NLS Segment(s)
PositionSequence
112-132KLSKKQIESLKKQKKQKKMEK
Subcellular Location(s) nucl 13, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MSSAKSSYSRLEALRKRVETVKPVKTKALKTSLNEKNELPPPPAEPEGPIVGPMTAIEQTINSAKYDKPIVSQKTGKGYGADDRAFRQMNVYFDYASYAEQCAHGKPNFAPKLSKKQIESLKKQKKQKKMEKLKEWLYND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.53
3 0.53
4 0.56
5 0.57
6 0.56
7 0.58
8 0.59
9 0.57
10 0.58
11 0.62
12 0.62
13 0.63
14 0.61
15 0.61
16 0.57
17 0.53
18 0.61
19 0.61
20 0.58
21 0.55
22 0.48
23 0.46
24 0.46
25 0.44
26 0.36
27 0.29
28 0.27
29 0.29
30 0.3
31 0.24
32 0.2
33 0.2
34 0.19
35 0.18
36 0.16
37 0.12
38 0.1
39 0.09
40 0.08
41 0.07
42 0.05
43 0.06
44 0.05
45 0.05
46 0.06
47 0.08
48 0.09
49 0.08
50 0.09
51 0.09
52 0.11
53 0.13
54 0.12
55 0.13
56 0.2
57 0.23
58 0.26
59 0.29
60 0.29
61 0.33
62 0.34
63 0.31
64 0.25
65 0.23
66 0.23
67 0.24
68 0.23
69 0.18
70 0.19
71 0.23
72 0.22
73 0.21
74 0.2
75 0.18
76 0.19
77 0.21
78 0.2
79 0.16
80 0.16
81 0.18
82 0.15
83 0.13
84 0.11
85 0.09
86 0.09
87 0.1
88 0.11
89 0.11
90 0.17
91 0.17
92 0.19
93 0.2
94 0.3
95 0.33
96 0.34
97 0.4
98 0.4
99 0.5
100 0.55
101 0.59
102 0.51
103 0.56
104 0.64
105 0.66
106 0.7
107 0.71
108 0.74
109 0.77
110 0.85
111 0.85
112 0.86
113 0.87
114 0.87
115 0.88
116 0.88
117 0.91
118 0.91
119 0.92
120 0.9