Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075B5E9

Protein Details
Accession A0A075B5E9   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
3-29QGLIKKIKPSNQNAKKGKKVLKPKSTTHydrophilic
NLS Segment(s)
PositionSequence
8-26KIKPSNQNAKKGKKVLKPK
69-82KKADDSKKGKKGKK
Subcellular Location(s) nucl 12.5, mito 9.5, cyto_nucl 8.833, cyto_mito 7.333, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGLIKKIKPSNQNAKKGKKVLKPKSTTALKTLKMQQKLSAQINNNLEKVMAQRAGACGKLNIIKVDKKADDSKKGKKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.81
4 0.82
5 0.82
6 0.82
7 0.79
8 0.8
9 0.8
10 0.81
11 0.77
12 0.73
13 0.74
14 0.71
15 0.64
16 0.6
17 0.56
18 0.48
19 0.47
20 0.51
21 0.48
22 0.47
23 0.45
24 0.43
25 0.4
26 0.44
27 0.42
28 0.39
29 0.34
30 0.35
31 0.39
32 0.37
33 0.32
34 0.27
35 0.23
36 0.19
37 0.19
38 0.16
39 0.12
40 0.1
41 0.11
42 0.13
43 0.15
44 0.15
45 0.14
46 0.11
47 0.13
48 0.17
49 0.18
50 0.19
51 0.22
52 0.25
53 0.28
54 0.35
55 0.34
56 0.36
57 0.44
58 0.47
59 0.53
60 0.58
61 0.65
62 0.68