Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075ATW0

Protein Details
Accession A0A075ATW0    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-45KVEKVDKPKTPRGRAKKRVLYKRRYKMMVBasic
NLS Segment(s)
PositionSequence
12-41KSQTPKVEKVDKPKTPRGRAKKRVLYKRRY
Subcellular Location(s) nucl 10, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MHGSLARAGKVKSQTPKVEKVDKPKTPRGRAKKRVLYKRRYKMMVGAASGQKIRMNPNTPSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.63
4 0.63
5 0.67
6 0.65
7 0.67
8 0.69
9 0.67
10 0.68
11 0.69
12 0.72
13 0.72
14 0.78
15 0.78
16 0.79
17 0.82
18 0.85
19 0.84
20 0.85
21 0.86
22 0.86
23 0.85
24 0.85
25 0.85
26 0.83
27 0.77
28 0.68
29 0.63
30 0.62
31 0.56
32 0.47
33 0.42
34 0.36
35 0.35
36 0.34
37 0.29
38 0.23
39 0.21
40 0.25
41 0.28
42 0.31