Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AQF1

Protein Details
Accession A0A075AQF1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
37-58IEQTIDREKRRREEEKRIESELAcidic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 8, golg 2, mito 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000961  AGC-kinase_C  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR017441  Protein_kinase_ATP_BS  
Gene Ontology GO:0051285  C:cell cortex of cell tip  
GO:0032153  C:cell division site  
GO:0005935  C:cellular bud neck  
GO:0005934  C:cellular bud tip  
GO:0035838  C:growing cell tip  
GO:0000131  C:incipient cellular bud site  
GO:0043332  C:mating projection tip  
GO:0005634  C:nucleus  
GO:1902554  C:serine/threonine protein kinase complex  
GO:0005524  F:ATP binding  
GO:0042802  F:identical protein binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0007118  P:budding cell apical bud growth  
GO:0071472  P:cellular response to salt stress  
GO:0030866  P:cortical actin cytoskeleton organization  
GO:0030950  P:establishment or maintenance of actin cytoskeleton polarity  
GO:0097248  P:maintenance of protein location in cell cortex of cell tip  
GO:2000247  P:positive regulation of establishment or maintenance of bipolar cell polarity regulating cell shape  
GO:0045921  P:positive regulation of exocytosis  
GO:0006468  P:protein phosphorylation  
GO:0062200  P:RAM/MOR signaling pathway  
GO:0032995  P:regulation of fungal-type cell wall biogenesis  
GO:0060237  P:regulation of fungal-type cell wall organization  
GO:0050708  P:regulation of protein secretion  
GO:0000920  P:septum digestion after cytokinesis  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS51285  AGC_KINASE_CTER  
PS00107  PROTEIN_KINASE_ATP  
PS50011  PROTEIN_KINASE_DOM  
Amino Acid Sequences MTDNGDFTRSTEGYSKITIDNAAKAKLMLEKYYQQVIEQTIDREKRRREEEKRIESELYSNDRKSRLLAQYGTKESDYLRLRRTKLDISDFQTVKVIGKGAFGEVRLVQKRDSGKIYAMKTLRKSEMLKRDQLSHVQAERDILADSESPWVVQLFFSFQDETYLYLVMEYLPGGDMMTMLIKYDIFPEDFARFYMAECVMAIESVHQLGFIHSTDIKPDNLLVDREGHVKLSDFGLSTGLHKRYDYSKLQETPKKTVQNNLTVSKQDTIASWKKSRRQLAYSTVGTPDYIAPEVFMQKGYGKECDWWSLGAILFECLAGYPPFCSDSPHETYKRILSWKSELEFPSDIHISSDAEDLIRKLLCDADNRLGRQSVSDIKDHPFFKGIDWDNLRNQKPPFVPELTSLTDTRYFPTDELEDVPQDLTTNHLTENLKSSTLIRRRDLAFVGYTYKRFDMMTRRGGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.24
4 0.26
5 0.27
6 0.25
7 0.29
8 0.3
9 0.29
10 0.27
11 0.26
12 0.26
13 0.28
14 0.29
15 0.25
16 0.26
17 0.3
18 0.33
19 0.39
20 0.37
21 0.31
22 0.32
23 0.32
24 0.31
25 0.28
26 0.27
27 0.3
28 0.37
29 0.43
30 0.47
31 0.52
32 0.57
33 0.64
34 0.71
35 0.72
36 0.77
37 0.82
38 0.84
39 0.83
40 0.78
41 0.71
42 0.61
43 0.56
44 0.51
45 0.48
46 0.42
47 0.39
48 0.39
49 0.39
50 0.39
51 0.37
52 0.4
53 0.39
54 0.4
55 0.42
56 0.45
57 0.51
58 0.54
59 0.54
60 0.45
61 0.39
62 0.33
63 0.37
64 0.36
65 0.33
66 0.37
67 0.42
68 0.44
69 0.49
70 0.54
71 0.52
72 0.52
73 0.55
74 0.53
75 0.51
76 0.59
77 0.53
78 0.48
79 0.44
80 0.38
81 0.3
82 0.25
83 0.22
84 0.12
85 0.14
86 0.14
87 0.13
88 0.14
89 0.13
90 0.14
91 0.14
92 0.21
93 0.24
94 0.25
95 0.24
96 0.28
97 0.31
98 0.33
99 0.35
100 0.3
101 0.31
102 0.36
103 0.37
104 0.39
105 0.4
106 0.41
107 0.42
108 0.45
109 0.42
110 0.41
111 0.43
112 0.45
113 0.52
114 0.52
115 0.54
116 0.51
117 0.53
118 0.51
119 0.52
120 0.47
121 0.42
122 0.38
123 0.33
124 0.31
125 0.27
126 0.24
127 0.2
128 0.16
129 0.1
130 0.09
131 0.08
132 0.08
133 0.09
134 0.09
135 0.08
136 0.08
137 0.08
138 0.08
139 0.07
140 0.07
141 0.07
142 0.08
143 0.1
144 0.1
145 0.09
146 0.11
147 0.12
148 0.13
149 0.11
150 0.11
151 0.09
152 0.08
153 0.08
154 0.06
155 0.06
156 0.04
157 0.04
158 0.03
159 0.04
160 0.04
161 0.03
162 0.03
163 0.03
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.05
170 0.06
171 0.07
172 0.07
173 0.08
174 0.1
175 0.11
176 0.11
177 0.11
178 0.11
179 0.1
180 0.1
181 0.12
182 0.1
183 0.09
184 0.09
185 0.09
186 0.07
187 0.07
188 0.07
189 0.05
190 0.05
191 0.05
192 0.05
193 0.04
194 0.04
195 0.05
196 0.06
197 0.05
198 0.07
199 0.07
200 0.07
201 0.1
202 0.11
203 0.11
204 0.1
205 0.1
206 0.1
207 0.11
208 0.12
209 0.1
210 0.1
211 0.11
212 0.13
213 0.13
214 0.12
215 0.11
216 0.11
217 0.11
218 0.09
219 0.09
220 0.07
221 0.07
222 0.08
223 0.08
224 0.1
225 0.14
226 0.15
227 0.15
228 0.15
229 0.16
230 0.18
231 0.24
232 0.26
233 0.26
234 0.31
235 0.36
236 0.43
237 0.47
238 0.47
239 0.47
240 0.51
241 0.53
242 0.47
243 0.49
244 0.46
245 0.5
246 0.51
247 0.47
248 0.42
249 0.36
250 0.37
251 0.3
252 0.27
253 0.19
254 0.15
255 0.19
256 0.23
257 0.27
258 0.31
259 0.36
260 0.42
261 0.49
262 0.56
263 0.54
264 0.53
265 0.54
266 0.55
267 0.56
268 0.51
269 0.45
270 0.39
271 0.33
272 0.28
273 0.23
274 0.16
275 0.11
276 0.1
277 0.08
278 0.07
279 0.08
280 0.1
281 0.09
282 0.09
283 0.08
284 0.1
285 0.13
286 0.14
287 0.15
288 0.15
289 0.18
290 0.19
291 0.21
292 0.2
293 0.18
294 0.16
295 0.16
296 0.16
297 0.13
298 0.12
299 0.09
300 0.08
301 0.07
302 0.07
303 0.05
304 0.06
305 0.06
306 0.06
307 0.06
308 0.07
309 0.1
310 0.1
311 0.13
312 0.15
313 0.21
314 0.27
315 0.33
316 0.35
317 0.34
318 0.36
319 0.37
320 0.38
321 0.37
322 0.34
323 0.31
324 0.35
325 0.39
326 0.38
327 0.39
328 0.35
329 0.35
330 0.34
331 0.3
332 0.28
333 0.23
334 0.22
335 0.17
336 0.17
337 0.13
338 0.13
339 0.14
340 0.09
341 0.09
342 0.1
343 0.09
344 0.11
345 0.11
346 0.09
347 0.09
348 0.13
349 0.15
350 0.18
351 0.23
352 0.29
353 0.34
354 0.35
355 0.37
356 0.34
357 0.32
358 0.29
359 0.29
360 0.29
361 0.26
362 0.28
363 0.28
364 0.3
365 0.37
366 0.36
367 0.33
368 0.29
369 0.27
370 0.26
371 0.32
372 0.32
373 0.34
374 0.39
375 0.42
376 0.46
377 0.55
378 0.55
379 0.51
380 0.5
381 0.49
382 0.46
383 0.46
384 0.44
385 0.39
386 0.39
387 0.36
388 0.4
389 0.37
390 0.37
391 0.33
392 0.3
393 0.31
394 0.3
395 0.28
396 0.26
397 0.24
398 0.21
399 0.25
400 0.23
401 0.2
402 0.23
403 0.23
404 0.21
405 0.2
406 0.2
407 0.16
408 0.15
409 0.13
410 0.13
411 0.14
412 0.14
413 0.13
414 0.19
415 0.21
416 0.22
417 0.29
418 0.27
419 0.25
420 0.25
421 0.28
422 0.32
423 0.38
424 0.43
425 0.4
426 0.45
427 0.47
428 0.51
429 0.5
430 0.43
431 0.38
432 0.33
433 0.37
434 0.35
435 0.34
436 0.33
437 0.31
438 0.29
439 0.27
440 0.3
441 0.34
442 0.38