Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AML2

Protein Details
Accession A0A075AML2   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-41NEEKEEPARRNRKRKDDEDNDDKKFAcidic
NLS Segment(s)
PositionSequence
22-31EPARRNRKRK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MQERIMQKEKKVAKEDNEEKEEPARRNRKRKDDEDNDDKKFEKEFEIHFDQNLLKKIAVGGVGAYLLYNILDVDIHNGHETSFQQFASELLPSGNVEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.69
4 0.68
5 0.61
6 0.55
7 0.56
8 0.55
9 0.48
10 0.51
11 0.53
12 0.56
13 0.65
14 0.73
15 0.77
16 0.8
17 0.83
18 0.84
19 0.83
20 0.83
21 0.82
22 0.8
23 0.72
24 0.65
25 0.58
26 0.47
27 0.38
28 0.3
29 0.22
30 0.18
31 0.17
32 0.21
33 0.26
34 0.25
35 0.24
36 0.24
37 0.23
38 0.23
39 0.24
40 0.19
41 0.13
42 0.13
43 0.13
44 0.12
45 0.11
46 0.08
47 0.06
48 0.05
49 0.05
50 0.05
51 0.04
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.07
61 0.08
62 0.09
63 0.09
64 0.1
65 0.1
66 0.12
67 0.13
68 0.13
69 0.14
70 0.13
71 0.13
72 0.13
73 0.14
74 0.13
75 0.13
76 0.1
77 0.08
78 0.1