Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075ATV8

Protein Details
Accession A0A075ATV8    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-31TGGSLKLKLKEKKKKTSNLNSSSPLHydrophilic
NLS Segment(s)
PositionSequence
14-21KLKEKKKK
53-68KREKDRILKKAAKSHK
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Amino Acid Sequences MSDYDFTGGSLKLKLKEKKKKTSNLNSSSPLKSPDIVVTKTKAEMAHEKVLEKREKDRILKKAAKSHKERVQEMNKFLDSLSEHYDCPKTNGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.48
3 0.59
4 0.67
5 0.74
6 0.8
7 0.83
8 0.85
9 0.88
10 0.88
11 0.85
12 0.81
13 0.75
14 0.71
15 0.63
16 0.54
17 0.46
18 0.37
19 0.3
20 0.25
21 0.25
22 0.24
23 0.24
24 0.24
25 0.23
26 0.22
27 0.22
28 0.23
29 0.18
30 0.16
31 0.19
32 0.22
33 0.25
34 0.24
35 0.25
36 0.26
37 0.31
38 0.33
39 0.29
40 0.29
41 0.32
42 0.38
43 0.44
44 0.49
45 0.51
46 0.57
47 0.62
48 0.62
49 0.64
50 0.67
51 0.69
52 0.68
53 0.7
54 0.69
55 0.69
56 0.68
57 0.68
58 0.69
59 0.67
60 0.63
61 0.6
62 0.53
63 0.45
64 0.41
65 0.36
66 0.27
67 0.24
68 0.26
69 0.22
70 0.22
71 0.25
72 0.29
73 0.26