Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075ASV4

Protein Details
Accession A0A075ASV4    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
26-45ISDKCFKKCVPKIQNKLEKQHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.833, nucl 10.5, mito_nucl 9.166, cyto 9, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004217  Tim10-like  
IPR035427  Tim10-like_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF02953  zf-Tim10_DDP  
Amino Acid Sequences MSEQILEGEGAQVDQLLATFSLLTDISDKCFKKCVPKIQNKLEKQEETCLAYCTARYFDVKLLVAKRLQSNSIELSQRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.06
11 0.07
12 0.08
13 0.1
14 0.17
15 0.18
16 0.18
17 0.22
18 0.23
19 0.31
20 0.38
21 0.46
22 0.5
23 0.6
24 0.67
25 0.73
26 0.81
27 0.74
28 0.74
29 0.69
30 0.61
31 0.52
32 0.48
33 0.4
34 0.34
35 0.32
36 0.27
37 0.22
38 0.19
39 0.18
40 0.15
41 0.15
42 0.13
43 0.14
44 0.14
45 0.15
46 0.19
47 0.2
48 0.23
49 0.24
50 0.25
51 0.26
52 0.28
53 0.32
54 0.3
55 0.31
56 0.29
57 0.3
58 0.31
59 0.35