Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075B013

Protein Details
Accession A0A075B013    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
60-81VAPGSHKRRAFKKKTTVLTPEQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 11.833, mito_nucl 11.833, mito 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008851  TFIIF-alpha  
IPR011039  TFIIF_interaction  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF05793  TFIIF_alpha  
Amino Acid Sequences MSSKEYKLTALRTTDKQCIMMFPSKTKLFGPLSMEKMEAEGEAVSDISKTLPEGYDPSLVAPGSHKRRAFKKKTTVLTPEQLKKESVQNNLSLQDGNGASFIGREEGGLEAGEYAILVKTGENSFAMIPVDKWYRFQNKIHYQTLSLEEAEQKPEIEEYGFRQMDDEIEGERNVEEDVEDIAKPPRDDEEIDFDEVFSDDDEKIGEGPEMEEDEQVINKITLKLIKQKAFKKRDTSEEVEENEELSLTGKDLRRIVRRLEKNQDYESDDEKDPYADEDDIDTSSLPSTTSGTATPMSSRMFSGFSSGISSVEERRKPELLSKSTTSSQSSNKEKEMIRPLPKLAPAPSSQPISIDVLRAEVINVLKTNNLTAKELINMFKRKIKDNTKDFQSVVKQVAEMDKTTRILKLKAEFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.53
3 0.51
4 0.46
5 0.42
6 0.43
7 0.43
8 0.41
9 0.38
10 0.43
11 0.42
12 0.43
13 0.4
14 0.41
15 0.36
16 0.37
17 0.4
18 0.39
19 0.41
20 0.41
21 0.41
22 0.33
23 0.31
24 0.27
25 0.19
26 0.13
27 0.09
28 0.08
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.08
38 0.09
39 0.1
40 0.13
41 0.16
42 0.19
43 0.19
44 0.19
45 0.19
46 0.18
47 0.17
48 0.18
49 0.25
50 0.29
51 0.36
52 0.39
53 0.43
54 0.54
55 0.65
56 0.71
57 0.72
58 0.75
59 0.77
60 0.82
61 0.83
62 0.8
63 0.76
64 0.74
65 0.73
66 0.7
67 0.65
68 0.59
69 0.52
70 0.47
71 0.49
72 0.46
73 0.44
74 0.4
75 0.39
76 0.4
77 0.39
78 0.38
79 0.29
80 0.24
81 0.21
82 0.17
83 0.14
84 0.11
85 0.1
86 0.09
87 0.09
88 0.09
89 0.06
90 0.06
91 0.05
92 0.06
93 0.06
94 0.07
95 0.06
96 0.06
97 0.05
98 0.05
99 0.05
100 0.04
101 0.04
102 0.03
103 0.04
104 0.04
105 0.04
106 0.06
107 0.07
108 0.08
109 0.08
110 0.09
111 0.09
112 0.1
113 0.11
114 0.08
115 0.09
116 0.12
117 0.16
118 0.16
119 0.17
120 0.23
121 0.3
122 0.34
123 0.38
124 0.44
125 0.5
126 0.57
127 0.59
128 0.53
129 0.46
130 0.45
131 0.45
132 0.36
133 0.26
134 0.2
135 0.19
136 0.19
137 0.2
138 0.17
139 0.13
140 0.12
141 0.12
142 0.11
143 0.09
144 0.08
145 0.1
146 0.18
147 0.18
148 0.18
149 0.18
150 0.18
151 0.18
152 0.18
153 0.15
154 0.08
155 0.09
156 0.09
157 0.09
158 0.08
159 0.08
160 0.07
161 0.06
162 0.05
163 0.04
164 0.05
165 0.06
166 0.06
167 0.07
168 0.09
169 0.11
170 0.11
171 0.11
172 0.11
173 0.12
174 0.14
175 0.15
176 0.2
177 0.2
178 0.21
179 0.21
180 0.19
181 0.17
182 0.16
183 0.14
184 0.07
185 0.06
186 0.05
187 0.05
188 0.05
189 0.05
190 0.05
191 0.05
192 0.05
193 0.04
194 0.04
195 0.04
196 0.06
197 0.06
198 0.06
199 0.06
200 0.06
201 0.06
202 0.06
203 0.06
204 0.05
205 0.06
206 0.06
207 0.07
208 0.09
209 0.11
210 0.2
211 0.26
212 0.32
213 0.38
214 0.45
215 0.55
216 0.6
217 0.64
218 0.63
219 0.61
220 0.63
221 0.62
222 0.6
223 0.54
224 0.51
225 0.47
226 0.4
227 0.36
228 0.29
229 0.22
230 0.17
231 0.12
232 0.08
233 0.07
234 0.05
235 0.1
236 0.11
237 0.13
238 0.17
239 0.23
240 0.28
241 0.31
242 0.37
243 0.43
244 0.5
245 0.55
246 0.62
247 0.63
248 0.61
249 0.61
250 0.57
251 0.5
252 0.45
253 0.4
254 0.34
255 0.28
256 0.25
257 0.23
258 0.2
259 0.17
260 0.15
261 0.14
262 0.09
263 0.09
264 0.1
265 0.1
266 0.1
267 0.1
268 0.09
269 0.07
270 0.07
271 0.07
272 0.06
273 0.06
274 0.07
275 0.08
276 0.09
277 0.09
278 0.1
279 0.11
280 0.12
281 0.12
282 0.13
283 0.13
284 0.13
285 0.13
286 0.13
287 0.13
288 0.13
289 0.16
290 0.13
291 0.12
292 0.14
293 0.14
294 0.13
295 0.13
296 0.14
297 0.16
298 0.24
299 0.26
300 0.27
301 0.31
302 0.33
303 0.33
304 0.4
305 0.43
306 0.41
307 0.44
308 0.44
309 0.45
310 0.46
311 0.47
312 0.43
313 0.37
314 0.39
315 0.41
316 0.47
317 0.46
318 0.45
319 0.48
320 0.47
321 0.51
322 0.54
323 0.54
324 0.53
325 0.53
326 0.54
327 0.52
328 0.54
329 0.49
330 0.42
331 0.38
332 0.32
333 0.35
334 0.36
335 0.34
336 0.31
337 0.28
338 0.28
339 0.28
340 0.27
341 0.23
342 0.19
343 0.17
344 0.17
345 0.16
346 0.14
347 0.12
348 0.12
349 0.13
350 0.14
351 0.13
352 0.14
353 0.15
354 0.18
355 0.2
356 0.21
357 0.21
358 0.22
359 0.23
360 0.26
361 0.28
362 0.3
363 0.33
364 0.36
365 0.37
366 0.42
367 0.44
368 0.47
369 0.55
370 0.6
371 0.63
372 0.66
373 0.72
374 0.73
375 0.75
376 0.68
377 0.66
378 0.62
379 0.56
380 0.51
381 0.43
382 0.36
383 0.33
384 0.39
385 0.34
386 0.29
387 0.27
388 0.27
389 0.29
390 0.3
391 0.33
392 0.31
393 0.31
394 0.37