Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AT37

Protein Details
Accession A0A075AT37    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-40TSQENSSKIEKKRKKIEDEQDTNSFHydrophilic
NLS Segment(s)
PositionSequence
26-29KKRK
Subcellular Location(s) nucl 15.5, mito_nucl 12.666, cyto_nucl 10.333, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002043  UDG_fam1  
IPR018085  Ura-DNA_Glyclase_AS  
IPR005122  Uracil-DNA_glycosylase-like  
IPR036895  Uracil-DNA_glycosylase-like_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005634  C:nucleus  
GO:0004844  F:uracil DNA N-glycosylase activity  
GO:0006284  P:base-excision repair  
Pfam View protein in Pfam  
PF03167  UDG  
PROSITE View protein in PROSITE  
PS00130  U_DNA_GLYCOSYLASE  
CDD cd10027  UDG-F1-like  
Amino Acid Sequences MTRLTNFFKRKSKLETSQENSSKIEKKRKKIEDEQDTNSFKDLEDKYLHESWSCMLKSEIEKPYFKRLKHFLEEELKRGKTIFPPKHLIYSWSNYCSFDQIKIVIIGQDPYHNHDQAMGLCFSVPMGTILPPSLKNIFKELKSEYSDFVIPNHGCLYGWAKQGVLLLNATLTVEAHKAYSHAKKGWEEFTDKIITCISNNRQNVVFMLWGGHAQQKEKLIKSDCHCILKSAHPSPLSASRGFLGNNHFIKANEYLNQKGIKEIDWSFLPNRENL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.73
4 0.77
5 0.76
6 0.7
7 0.63
8 0.6
9 0.58
10 0.56
11 0.61
12 0.59
13 0.64
14 0.72
15 0.79
16 0.82
17 0.84
18 0.86
19 0.86
20 0.85
21 0.81
22 0.79
23 0.72
24 0.64
25 0.54
26 0.44
27 0.32
28 0.33
29 0.28
30 0.24
31 0.24
32 0.26
33 0.3
34 0.33
35 0.34
36 0.26
37 0.25
38 0.22
39 0.27
40 0.24
41 0.2
42 0.17
43 0.21
44 0.24
45 0.32
46 0.37
47 0.34
48 0.38
49 0.4
50 0.51
51 0.53
52 0.5
53 0.5
54 0.5
55 0.54
56 0.57
57 0.56
58 0.52
59 0.56
60 0.57
61 0.55
62 0.54
63 0.46
64 0.4
65 0.38
66 0.33
67 0.31
68 0.39
69 0.4
70 0.39
71 0.46
72 0.47
73 0.51
74 0.49
75 0.45
76 0.39
77 0.39
78 0.37
79 0.33
80 0.33
81 0.3
82 0.3
83 0.3
84 0.26
85 0.2
86 0.18
87 0.15
88 0.15
89 0.14
90 0.14
91 0.11
92 0.1
93 0.1
94 0.09
95 0.11
96 0.11
97 0.15
98 0.18
99 0.17
100 0.16
101 0.17
102 0.17
103 0.16
104 0.18
105 0.13
106 0.1
107 0.09
108 0.09
109 0.08
110 0.07
111 0.06
112 0.04
113 0.04
114 0.04
115 0.05
116 0.05
117 0.07
118 0.07
119 0.09
120 0.12
121 0.13
122 0.14
123 0.18
124 0.21
125 0.2
126 0.23
127 0.24
128 0.24
129 0.26
130 0.26
131 0.22
132 0.21
133 0.22
134 0.19
135 0.17
136 0.18
137 0.15
138 0.15
139 0.15
140 0.13
141 0.11
142 0.12
143 0.16
144 0.14
145 0.16
146 0.15
147 0.15
148 0.15
149 0.17
150 0.17
151 0.13
152 0.09
153 0.07
154 0.07
155 0.07
156 0.06
157 0.05
158 0.04
159 0.04
160 0.04
161 0.05
162 0.05
163 0.05
164 0.06
165 0.12
166 0.17
167 0.21
168 0.23
169 0.27
170 0.3
171 0.33
172 0.37
173 0.34
174 0.33
175 0.3
176 0.31
177 0.31
178 0.28
179 0.25
180 0.22
181 0.19
182 0.17
183 0.23
184 0.25
185 0.29
186 0.3
187 0.31
188 0.31
189 0.31
190 0.31
191 0.25
192 0.2
193 0.12
194 0.12
195 0.1
196 0.1
197 0.11
198 0.13
199 0.13
200 0.14
201 0.17
202 0.23
203 0.28
204 0.3
205 0.36
206 0.37
207 0.43
208 0.45
209 0.52
210 0.5
211 0.5
212 0.48
213 0.44
214 0.43
215 0.44
216 0.49
217 0.43
218 0.44
219 0.38
220 0.39
221 0.4
222 0.45
223 0.41
224 0.33
225 0.3
226 0.26
227 0.27
228 0.27
229 0.25
230 0.23
231 0.28
232 0.28
233 0.28
234 0.29
235 0.27
236 0.3
237 0.31
238 0.28
239 0.26
240 0.29
241 0.3
242 0.34
243 0.37
244 0.34
245 0.34
246 0.32
247 0.28
248 0.29
249 0.28
250 0.27
251 0.25
252 0.29
253 0.28
254 0.32