Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075ASY1

Protein Details
Accession A0A075ASY1    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
26-45SRPENKKCADCKKKDSRWVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 7, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044520  ARF_GAP_AGD5/15  
IPR037278  ARFGAP/RecO  
IPR001164  ArfGAP_dom  
IPR038508  ArfGAP_dom_sf  
Gene Ontology GO:0005096  F:GTPase activator activity  
Pfam View protein in Pfam  
PF01412  ArfGap  
PROSITE View protein in PROSITE  
PS50115  ARFGAP  
CDD cd08204  ArfGap  
Amino Acid Sequences MSTRQERQSNKTQNDMHLQILKELVSRPENKKCADCKKKDSRWVSINLGVFVCIRCSGIHRSIGVHITKIRSIDLDTFTPEQIQEVSKWGNAKANYYWEASLPAGHEPNES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.58
3 0.52
4 0.46
5 0.43
6 0.35
7 0.32
8 0.27
9 0.21
10 0.2
11 0.2
12 0.2
13 0.26
14 0.31
15 0.39
16 0.43
17 0.44
18 0.5
19 0.54
20 0.6
21 0.64
22 0.65
23 0.66
24 0.72
25 0.78
26 0.81
27 0.77
28 0.74
29 0.68
30 0.66
31 0.6
32 0.54
33 0.47
34 0.38
35 0.33
36 0.25
37 0.2
38 0.15
39 0.12
40 0.07
41 0.07
42 0.06
43 0.09
44 0.12
45 0.14
46 0.16
47 0.16
48 0.17
49 0.18
50 0.22
51 0.19
52 0.17
53 0.17
54 0.17
55 0.17
56 0.17
57 0.16
58 0.13
59 0.14
60 0.15
61 0.16
62 0.15
63 0.18
64 0.18
65 0.18
66 0.18
67 0.16
68 0.14
69 0.12
70 0.12
71 0.1
72 0.12
73 0.13
74 0.15
75 0.17
76 0.17
77 0.22
78 0.22
79 0.25
80 0.24
81 0.29
82 0.29
83 0.3
84 0.29
85 0.24
86 0.26
87 0.22
88 0.21
89 0.16
90 0.19
91 0.19