Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AQA8

Protein Details
Accession A0A075AQA8    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
98-133ASAPTDKGGRKQRKEKKNRLKKFRGTRKEKRERKKQBasic
NLS Segment(s)
PositionSequence
103-133DKGGRKQRKEKKNRLKKFRGTRKEKRERKKQ
Subcellular Location(s) mito 17.5, mito_nucl 12.166, nucl 5.5, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MDSTSVTLRTKKFMTNRLLQRKQMVVDVLHPGKANVSKDDIRNKLATIYKVNKDVVSVFGFRTAFGGSKSTGFALIYDSVEAAKKFEPKHRLISAGLASAPTDKGGRKQRKEKKNRLKKFRGTRKEKRERKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.55
3 0.64
4 0.7
5 0.74
6 0.7
7 0.68
8 0.64
9 0.58
10 0.51
11 0.43
12 0.33
13 0.29
14 0.33
15 0.29
16 0.26
17 0.25
18 0.21
19 0.22
20 0.25
21 0.24
22 0.18
23 0.22
24 0.24
25 0.3
26 0.38
27 0.38
28 0.37
29 0.36
30 0.34
31 0.34
32 0.34
33 0.31
34 0.3
35 0.33
36 0.33
37 0.35
38 0.36
39 0.3
40 0.28
41 0.26
42 0.21
43 0.17
44 0.15
45 0.12
46 0.14
47 0.14
48 0.13
49 0.13
50 0.11
51 0.09
52 0.09
53 0.1
54 0.08
55 0.08
56 0.09
57 0.08
58 0.08
59 0.07
60 0.07
61 0.08
62 0.08
63 0.08
64 0.07
65 0.07
66 0.07
67 0.08
68 0.08
69 0.08
70 0.09
71 0.13
72 0.16
73 0.23
74 0.29
75 0.32
76 0.39
77 0.4
78 0.41
79 0.37
80 0.39
81 0.33
82 0.27
83 0.24
84 0.17
85 0.15
86 0.13
87 0.13
88 0.09
89 0.1
90 0.1
91 0.18
92 0.28
93 0.38
94 0.47
95 0.58
96 0.67
97 0.76
98 0.87
99 0.9
100 0.91
101 0.92
102 0.94
103 0.94
104 0.94
105 0.94
106 0.94
107 0.94
108 0.94
109 0.93
110 0.93
111 0.93
112 0.94
113 0.94