Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075ANE1

Protein Details
Accession A0A075ANE1    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-65TMESPKAKKRTHRLKSAKSSPLVHydrophilic
NLS Segment(s)
PositionSequence
48-57KAKKRTHRLK
Subcellular Location(s) nucl 21, cyto_nucl 13.333, mito_nucl 11.333, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAFMLRKSELEKEGASEEKLLEISPFRLDKAVAEKNEAPVKTTMESPKAKKRTHRLKSAKSSPLVNVISTTDLPQCHEEKSKSLNAEKLNELVKACEMIIENDRDCSSNSIKEDNPNIYQTGTLMRDREFRVPDCLSWLERSQIKDIAHLLSSFEHDILRNNFENISYFRDQFLIMKTRHDIERQIEGNISDPCSVFKKYGXLVLFSRNMVHFSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.23
4 0.2
5 0.18
6 0.18
7 0.15
8 0.13
9 0.12
10 0.13
11 0.17
12 0.17
13 0.16
14 0.17
15 0.17
16 0.19
17 0.26
18 0.31
19 0.27
20 0.33
21 0.34
22 0.38
23 0.44
24 0.41
25 0.35
26 0.3
27 0.31
28 0.26
29 0.3
30 0.28
31 0.3
32 0.37
33 0.4
34 0.49
35 0.55
36 0.58
37 0.62
38 0.69
39 0.72
40 0.74
41 0.79
42 0.79
43 0.81
44 0.87
45 0.87
46 0.83
47 0.74
48 0.68
49 0.58
50 0.56
51 0.46
52 0.36
53 0.27
54 0.21
55 0.21
56 0.18
57 0.18
58 0.13
59 0.12
60 0.14
61 0.16
62 0.16
63 0.17
64 0.22
65 0.21
66 0.22
67 0.27
68 0.29
69 0.29
70 0.31
71 0.33
72 0.31
73 0.33
74 0.3
75 0.28
76 0.25
77 0.23
78 0.21
79 0.16
80 0.14
81 0.11
82 0.1
83 0.09
84 0.08
85 0.08
86 0.1
87 0.12
88 0.11
89 0.12
90 0.12
91 0.12
92 0.12
93 0.14
94 0.13
95 0.14
96 0.15
97 0.18
98 0.18
99 0.21
100 0.23
101 0.23
102 0.23
103 0.21
104 0.2
105 0.17
106 0.16
107 0.13
108 0.14
109 0.13
110 0.13
111 0.13
112 0.13
113 0.18
114 0.2
115 0.24
116 0.24
117 0.23
118 0.27
119 0.27
120 0.27
121 0.26
122 0.26
123 0.22
124 0.22
125 0.22
126 0.2
127 0.22
128 0.24
129 0.23
130 0.26
131 0.25
132 0.24
133 0.25
134 0.22
135 0.2
136 0.18
137 0.16
138 0.12
139 0.14
140 0.12
141 0.11
142 0.1
143 0.1
144 0.15
145 0.17
146 0.21
147 0.2
148 0.2
149 0.2
150 0.2
151 0.22
152 0.19
153 0.23
154 0.22
155 0.22
156 0.21
157 0.22
158 0.22
159 0.21
160 0.25
161 0.25
162 0.22
163 0.25
164 0.27
165 0.3
166 0.33
167 0.33
168 0.33
169 0.3
170 0.39
171 0.36
172 0.35
173 0.33
174 0.3
175 0.32
176 0.29
177 0.27
178 0.19
179 0.18
180 0.19
181 0.21
182 0.22
183 0.19
184 0.19
185 0.21
186 0.22
187 0.26
188 0.26
189 0.26
190 0.28
191 0.28
192 0.31
193 0.3
194 0.28