Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AQR5

Protein Details
Accession A0A075AQR5    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-36ELSPEPPKSPKKQGKRKVLYPLLKDHydrophilic
NLS Segment(s)
PositionSequence
18-28PKSPKKQGKRK
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033469  CYTH-like_dom_sf  
IPR004206  mRNA_triPase_Cet1  
IPR037009  mRNA_triPase_Cet1_sf  
Gene Ontology GO:0004651  F:polynucleotide 5'-phosphatase activity  
GO:0006397  P:mRNA processing  
Pfam View protein in Pfam  
PF02940  mRNA_triPase  
Amino Acid Sequences MNDKKRARTDEELSPEPPKSPKKQGKRKVLYPLLKDYIPTNDLVLTVSDFLFHFMTIENIEIEAKIGHLIDNKTHQRIKPNVATDCGINNLFIQSSGYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.46
3 0.4
4 0.42
5 0.4
6 0.39
7 0.47
8 0.54
9 0.61
10 0.72
11 0.79
12 0.84
13 0.85
14 0.85
15 0.85
16 0.84
17 0.8
18 0.74
19 0.71
20 0.62
21 0.54
22 0.47
23 0.38
24 0.31
25 0.25
26 0.21
27 0.14
28 0.11
29 0.11
30 0.11
31 0.1
32 0.07
33 0.06
34 0.06
35 0.06
36 0.05
37 0.07
38 0.07
39 0.06
40 0.06
41 0.05
42 0.06
43 0.06
44 0.07
45 0.05
46 0.05
47 0.06
48 0.05
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.09
56 0.1
57 0.12
58 0.21
59 0.25
60 0.3
61 0.35
62 0.36
63 0.41
64 0.46
65 0.52
66 0.51
67 0.54
68 0.52
69 0.5
70 0.49
71 0.42
72 0.38
73 0.34
74 0.26
75 0.19
76 0.17
77 0.15
78 0.14
79 0.13