Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AYN3

Protein Details
Accession A0A075AYN3   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
133-158IPSDFFKRKAKERKDDSSKKIKKDTEBasic
NLS Segment(s)
PositionSequence
139-154KRKAKERKDDSSKKIK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.333, cyto 5, cyto_mito 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR003738  SRAP  
IPR036590  SRAP-like  
Gene Ontology GO:0008233  F:peptidase activity  
GO:0003697  F:single-stranded DNA binding  
GO:0006974  P:DNA damage response  
GO:0018142  P:protein-DNA covalent cross-linking  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF02586  SRAP  
Amino Acid Sequences MINVRSDSLIGPYAKTMYKNIKYTNRGIAIAQGDPVFFFAAIYDSNKNLGVDSYTIVTTSSKGSQMEKLHDRIPVILQQDEIDVWLGKGWNSEIENIIEDRSRIDLQYHKVAPLVNKVGTDGPELIQEVKEKIPSDFFKRKAKERKDDSSKKIKKDTEVINLAECTDLTNDEDKEEVIDLTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.25
4 0.3
5 0.37
6 0.42
7 0.49
8 0.56
9 0.59
10 0.62
11 0.64
12 0.57
13 0.51
14 0.46
15 0.42
16 0.35
17 0.31
18 0.27
19 0.19
20 0.16
21 0.14
22 0.15
23 0.1
24 0.08
25 0.07
26 0.05
27 0.06
28 0.07
29 0.1
30 0.11
31 0.11
32 0.13
33 0.14
34 0.13
35 0.12
36 0.12
37 0.1
38 0.09
39 0.1
40 0.1
41 0.09
42 0.09
43 0.09
44 0.09
45 0.08
46 0.1
47 0.1
48 0.11
49 0.12
50 0.14
51 0.19
52 0.21
53 0.27
54 0.29
55 0.3
56 0.3
57 0.31
58 0.29
59 0.24
60 0.23
61 0.21
62 0.18
63 0.16
64 0.14
65 0.13
66 0.13
67 0.12
68 0.1
69 0.07
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.07
78 0.07
79 0.08
80 0.09
81 0.09
82 0.1
83 0.1
84 0.1
85 0.08
86 0.07
87 0.07
88 0.09
89 0.09
90 0.08
91 0.1
92 0.14
93 0.17
94 0.24
95 0.24
96 0.22
97 0.23
98 0.24
99 0.23
100 0.25
101 0.25
102 0.18
103 0.18
104 0.19
105 0.19
106 0.18
107 0.19
108 0.14
109 0.11
110 0.11
111 0.12
112 0.11
113 0.11
114 0.11
115 0.12
116 0.12
117 0.14
118 0.14
119 0.15
120 0.2
121 0.23
122 0.31
123 0.37
124 0.41
125 0.48
126 0.53
127 0.62
128 0.66
129 0.72
130 0.74
131 0.74
132 0.8
133 0.81
134 0.86
135 0.84
136 0.85
137 0.82
138 0.79
139 0.8
140 0.74
141 0.68
142 0.67
143 0.66
144 0.64
145 0.63
146 0.56
147 0.5
148 0.46
149 0.41
150 0.32
151 0.25
152 0.17
153 0.12
154 0.12
155 0.12
156 0.16
157 0.16
158 0.17
159 0.17
160 0.16
161 0.16
162 0.16