FuNGI

A0A075AZX0

Protein Details

Accession

A0A075AZX0

Localization Confidence

Low

Confidence Score

8.5

NoLS Segment(s)

Position	Sequence	Protein Nature
16-39	ILYRFIKREWTLKRNRNREIFERT	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 13.5, cyto_nucl 10.333, mito 5.5, cyto_mito 5.499, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR031968 VASt
Gene Ontology	GO:0016020 C:membrane
Pfam	View protein in Pfam PF16016 VASt
PROSITE	View protein in PROSITE PS51778 VAST

Amino Acid Sequences

MITKTVTLTKVQRRDILYRFIKREWTLKRNRNREIFERTDDQCLSTTSDFPTDKNLDIDIFDDKRSLTSPASSINEYDAKLPEDEKPSVGRKIFSMIKSSSTEFLRKRRESEVSVRSEQRASSLKGSESNNSLRFNGMSQARSDSSVLYESAMAVNENLDAKKPLRYPLLEKEFKANIDDLYNAIFDLDSPDPLFTWSHRKVEGNVIKHTKWENNERFVEISIVFKVAFMPKCSSTSLETHKLLVFSSELIVLHIIEDSMKVPYGDCFKVQMKYVFEKRSDDRTNLTITGDVNFTKKCVWESRIEKGALDGCVAFVTSLNELLDSSIKNNHTVLRRTLSVPATLASKDGFARKKKDRILYSIPSSGPLMKEKIQILIHVIFIPLLKRKLHRMNRLGVAFWASSILFKISFCLFLFSFISFAYLYFYNFPSSNQRRVSALQSEIERFEIVLEKLRKSVAQVSDSIETIK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.63
2	0.63
3	0.64
4	0.64
5	0.64
6	0.65
7	0.62
8	0.64
9	0.6
10	0.64
11	0.63
12	0.64
13	0.66
14	0.7
15	0.78
16	0.8
17	0.86
18	0.86
19	0.83
20	0.81
21	0.79
22	0.76
23	0.72
24	0.68
25	0.61
26	0.59
27	0.52
28	0.45
29	0.37
30	0.32
31	0.31
32	0.26
33	0.26
34	0.21
35	0.27
36	0.26
37	0.25
38	0.32
39	0.3
40	0.3
41	0.29
42	0.28
43	0.22
44	0.22
45	0.23
46	0.21
47	0.2
48	0.18
49	0.18
50	0.17
51	0.18
52	0.18
53	0.2
54	0.15
55	0.16
56	0.17
57	0.23
58	0.26
59	0.26
60	0.25
61	0.26
62	0.27
63	0.25
64	0.26
65	0.22
66	0.2
67	0.2
68	0.21
69	0.23
70	0.25
71	0.26
72	0.25
73	0.28
74	0.31
75	0.36
76	0.36
77	0.32
78	0.27
79	0.33
80	0.37
81	0.33
82	0.35
83	0.3
84	0.32
85	0.34
86	0.35
87	0.32
88	0.29
89	0.35
90	0.35
91	0.43
92	0.49
93	0.49
94	0.51
95	0.54
96	0.56
97	0.55
98	0.59
99	0.58
100	0.55
101	0.58
102	0.56
103	0.52
104	0.48
105	0.42
106	0.37
107	0.34
108	0.3
109	0.29
110	0.28
111	0.27
112	0.31
113	0.33
114	0.31
115	0.31
116	0.34
117	0.34
118	0.33
119	0.32
120	0.28
121	0.26
122	0.24
123	0.25
124	0.23
125	0.19
126	0.19
127	0.22
128	0.22
129	0.23
130	0.22
131	0.17
132	0.15
133	0.15
134	0.14
135	0.11
136	0.1
137	0.09
138	0.09
139	0.09
140	0.07
141	0.06
142	0.06
143	0.06
144	0.08
145	0.07
146	0.08
147	0.1
148	0.11
149	0.16
150	0.17
151	0.21
152	0.24
153	0.26
154	0.31
155	0.39
156	0.47
157	0.45
158	0.44
159	0.46
160	0.43
161	0.41
162	0.37
163	0.28
164	0.19
165	0.17
166	0.16
167	0.11
168	0.1
169	0.1
170	0.08
171	0.07
172	0.06
173	0.05
174	0.08
175	0.08
176	0.08
177	0.08
178	0.08
179	0.09
180	0.1
181	0.11
182	0.08
183	0.17
184	0.2
185	0.22
186	0.24
187	0.25
188	0.25
189	0.35
190	0.4
191	0.35
192	0.38
193	0.4
194	0.38
195	0.4
196	0.4
197	0.34
198	0.32
199	0.39
200	0.37
201	0.39
202	0.4
203	0.39
204	0.37
205	0.33
206	0.3
207	0.2
208	0.16
209	0.1
210	0.1
211	0.08
212	0.08
213	0.08
214	0.11
215	0.12
216	0.12
217	0.15
218	0.15
219	0.17
220	0.18
221	0.19
222	0.17
223	0.2
224	0.23
225	0.26
226	0.25
227	0.25
228	0.25
229	0.24
230	0.21
231	0.18
232	0.13
233	0.08
234	0.08
235	0.07
236	0.06
237	0.06
238	0.06
239	0.05
240	0.05
241	0.05
242	0.04
243	0.03
244	0.04
245	0.04
246	0.04
247	0.05
248	0.05
249	0.05
250	0.07
251	0.11
252	0.12
253	0.12
254	0.15
255	0.17
256	0.19
257	0.21
258	0.23
259	0.22
260	0.28
261	0.34
262	0.35
263	0.34
264	0.37
265	0.38
266	0.43
267	0.43
268	0.38
269	0.34
270	0.33
271	0.34
272	0.3
273	0.27
274	0.19
275	0.16
276	0.16
277	0.14
278	0.12
279	0.12
280	0.11
281	0.11
282	0.11
283	0.12
284	0.13
285	0.18
286	0.2
287	0.27
288	0.32
289	0.38
290	0.43
291	0.42
292	0.39
293	0.36
294	0.35
295	0.27
296	0.23
297	0.16
298	0.1
299	0.1
300	0.1
301	0.08
302	0.05
303	0.06
304	0.06
305	0.07
306	0.07
307	0.07
308	0.07
309	0.08
310	0.09
311	0.08
312	0.09
313	0.13
314	0.14
315	0.15
316	0.17
317	0.21
318	0.25
319	0.29
320	0.32
321	0.31
322	0.32
323	0.32
324	0.37
325	0.33
326	0.29
327	0.25
328	0.22
329	0.2
330	0.18
331	0.17
332	0.12
333	0.12
334	0.12
335	0.19
336	0.25
337	0.29
338	0.37
339	0.45
340	0.53
341	0.59
342	0.66
343	0.64
344	0.65
345	0.68
346	0.67
347	0.64
348	0.6
349	0.53
350	0.46
351	0.42
352	0.36
353	0.29
354	0.25
355	0.24
356	0.22
357	0.26
358	0.26
359	0.3
360	0.28
361	0.27
362	0.28
363	0.26
364	0.24
365	0.2
366	0.19
367	0.13
368	0.14
369	0.16
370	0.16
371	0.19
372	0.21
373	0.24
374	0.33
375	0.43
376	0.53
377	0.6
378	0.62
379	0.66
380	0.71
381	0.7
382	0.61
383	0.52
384	0.46
385	0.35
386	0.28
387	0.22
388	0.14
389	0.12
390	0.12
391	0.13
392	0.09
393	0.09
394	0.12
395	0.12
396	0.14
397	0.14
398	0.17
399	0.16
400	0.18
401	0.2
402	0.18
403	0.17
404	0.14
405	0.16
406	0.11
407	0.11
408	0.12
409	0.11
410	0.12
411	0.14
412	0.15
413	0.17
414	0.18
415	0.2
416	0.28
417	0.34
418	0.41
419	0.42
420	0.43
421	0.43
422	0.46
423	0.5
424	0.45
425	0.43
426	0.39
427	0.4
428	0.41
429	0.38
430	0.36
431	0.3
432	0.23
433	0.21
434	0.21
435	0.18
436	0.24
437	0.27
438	0.27
439	0.29
440	0.31
441	0.3
442	0.3
443	0.37
444	0.34
445	0.34
446	0.34
447	0.37
448	0.38

A0A075AZX0

3D AlphaFold-predicted Structure Viewer