Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AY06

Protein Details
Accession A0A075AY06   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
59-83TVANSQKKKAKLRRSTKQGKRQEENHydrophilic
NLS Segment(s)
PositionSequence
65-78KKKAKLRRSTKQGK
Subcellular Location(s) nucl 15, cyto_nucl 13, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR028746  CatSper1  
Gene Ontology GO:0036128  C:CatSper complex  
GO:0005227  F:calcium activated cation channel activity  
GO:0030317  P:flagellated sperm motility  
Amino Acid Sequences MIGRHLYAETDPDHFGTLEKTFFRLFALITLDNWYIASVNILESLFTAILVNNLQQNKTVANSQKKKAKLRRSTKQGKRQEENSTNYLEIDESLEIDGKTSTKPSFEGLVDEKMIDSYYGINNKEVKDLFKTYYQLIASLELNQNSYGNQTRVLEDLVNLSKKKEIEDEKNLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.16
5 0.17
6 0.17
7 0.18
8 0.17
9 0.17
10 0.18
11 0.16
12 0.14
13 0.13
14 0.17
15 0.15
16 0.16
17 0.19
18 0.18
19 0.17
20 0.17
21 0.14
22 0.1
23 0.09
24 0.09
25 0.06
26 0.06
27 0.07
28 0.07
29 0.07
30 0.07
31 0.08
32 0.07
33 0.07
34 0.07
35 0.05
36 0.06
37 0.07
38 0.07
39 0.1
40 0.11
41 0.12
42 0.12
43 0.13
44 0.13
45 0.14
46 0.19
47 0.22
48 0.32
49 0.38
50 0.43
51 0.48
52 0.54
53 0.63
54 0.67
55 0.7
56 0.7
57 0.74
58 0.78
59 0.82
60 0.86
61 0.86
62 0.87
63 0.86
64 0.84
65 0.79
66 0.74
67 0.74
68 0.69
69 0.64
70 0.55
71 0.47
72 0.39
73 0.34
74 0.28
75 0.19
76 0.12
77 0.09
78 0.07
79 0.05
80 0.05
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.08
88 0.08
89 0.08
90 0.09
91 0.1
92 0.13
93 0.12
94 0.16
95 0.16
96 0.17
97 0.17
98 0.16
99 0.15
100 0.12
101 0.12
102 0.08
103 0.06
104 0.06
105 0.09
106 0.14
107 0.15
108 0.17
109 0.2
110 0.21
111 0.25
112 0.24
113 0.23
114 0.24
115 0.26
116 0.26
117 0.27
118 0.28
119 0.25
120 0.29
121 0.26
122 0.23
123 0.2
124 0.2
125 0.17
126 0.19
127 0.22
128 0.17
129 0.18
130 0.18
131 0.17
132 0.15
133 0.19
134 0.19
135 0.17
136 0.19
137 0.2
138 0.2
139 0.22
140 0.23
141 0.19
142 0.15
143 0.2
144 0.23
145 0.27
146 0.26
147 0.26
148 0.28
149 0.29
150 0.31
151 0.34
152 0.37
153 0.41