Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075AQ62

Protein Details
Accession A0A075AQ62    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-36NDLNWRGSRKENRERKEREKTLBasic
NLS Segment(s)
PositionSequence
23-34RKENRERKEREK
Subcellular Location(s) nucl 20.5, mito_nucl 13.5, mito 5.5
Family & Domain DBs
Amino Acid Sequences MPFDRNFSNKEIALNDLNWRGSRKENRERKEREKTLMKSRDEFKREMNILIMPALMKRPRGSFAIVFGDLKKWPNAVTWQRDIIQGKQSNLILPLSGLENICLLNELMFKYLSDRSGRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.27
4 0.28
5 0.26
6 0.27
7 0.26
8 0.32
9 0.4
10 0.45
11 0.53
12 0.61
13 0.66
14 0.74
15 0.81
16 0.81
17 0.83
18 0.79
19 0.76
20 0.76
21 0.75
22 0.75
23 0.75
24 0.68
25 0.62
26 0.63
27 0.63
28 0.57
29 0.53
30 0.46
31 0.45
32 0.43
33 0.39
34 0.34
35 0.25
36 0.21
37 0.2
38 0.16
39 0.08
40 0.07
41 0.09
42 0.09
43 0.1
44 0.11
45 0.12
46 0.14
47 0.15
48 0.17
49 0.15
50 0.17
51 0.19
52 0.18
53 0.18
54 0.16
55 0.16
56 0.15
57 0.16
58 0.13
59 0.1
60 0.1
61 0.12
62 0.2
63 0.26
64 0.3
65 0.32
66 0.34
67 0.35
68 0.39
69 0.4
70 0.34
71 0.36
72 0.34
73 0.32
74 0.33
75 0.33
76 0.29
77 0.28
78 0.25
79 0.16
80 0.12
81 0.12
82 0.09
83 0.11
84 0.09
85 0.08
86 0.09
87 0.09
88 0.09
89 0.09
90 0.07
91 0.07
92 0.09
93 0.09
94 0.1
95 0.11
96 0.11
97 0.13
98 0.16
99 0.19