FuNGI

A0A075AU66

Protein Details

Accession

A0A075AU66

Localization Confidence

Low

Confidence Score

9.3

NoLS Segment(s)

Position	Sequence	Protein Nature
69-88	IFDLSKKRLVQKKTKAQEEV	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 16.5, cyto_nucl 13, cyto 8.5

Family & Domain DBs

InterPro	View protein in InterPro IPR026983 DHC_fam IPR042222 Dynein_2_N IPR013602 Dynein_heavy_linker
Gene Ontology	GO:0030286 C:dynein complex GO:0045505 F:dynein intermediate chain binding GO:0051959 F:dynein light intermediate chain binding GO:0008569 F:minus-end-directed microtubule motor activity GO:0007018 P:microtubule-based movement
Pfam	View protein in Pfam PF08393 DHC_N2

Amino Acid Sequences

MKVPSTTEELCELINYLDKNSADETTGLKEEIYRGIKRINFLLNYAQLTEEDIKLNSVTMTWPERIGPIFDLSKKRLVQKKTKAQEEVKIKSQNLEAEVESLLDIVYKFQDCGILSETNEYVKKLRSIEIKIDELSFKIKEINKEEELLEFDLSPFGKFEEAKEALGPFKLLWDSVSTFQNEYNRWMTSAFIELDAHQIDEQVGNLYKSILKLTKTFKDLAVPRKVSEQIKNKIEKFKAYIPLITILRSPGLKNRHWKEMSDVAGVDMTPDEETTLSTYLEMDLSAHIPKFEEISEVAMKEFNFEKTLANMMEEWKNMTFNHMPYRDSGTFTLTAQEDLQALMNDQIIKIQTLKNSPLARNLEDLIAESEQTLMNIKETWNEWLKVQSGWLRLEPIFSSEETSQQMPLESRNFKQVDKIWREIMTQCLETPEILIMIKTPNLLEKLKECNSLIEEIQKVRNEQNHETPQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.17
2	0.16
3	0.15
4	0.19
5	0.19
6	0.21
7	0.22
8	0.22
9	0.19
10	0.2
11	0.21
12	0.2
13	0.21
14	0.19
15	0.17
16	0.17
17	0.18
18	0.25
19	0.28
20	0.26
21	0.27
22	0.34
23	0.36
24	0.37
25	0.41
26	0.4
27	0.35
28	0.36
29	0.4
30	0.37
31	0.36
32	0.34
33	0.29
34	0.22
35	0.25
36	0.25
37	0.2
38	0.17
39	0.16
40	0.17
41	0.16
42	0.16
43	0.12
44	0.1
45	0.1
46	0.13
47	0.17
48	0.17
49	0.17
50	0.18
51	0.2
52	0.21
53	0.21
54	0.19
55	0.19
56	0.22
57	0.28
58	0.33
59	0.34
60	0.4
61	0.42
62	0.49
63	0.52
64	0.57
65	0.61
66	0.66
67	0.74
68	0.75
69	0.8
70	0.8
71	0.76
72	0.76
73	0.75
74	0.7
75	0.68
76	0.65
77	0.57
78	0.52
79	0.5
80	0.45
81	0.37
82	0.34
83	0.26
84	0.21
85	0.2
86	0.17
87	0.14
88	0.11
89	0.08
90	0.07
91	0.06
92	0.05
93	0.08
94	0.08
95	0.08
96	0.08
97	0.12
98	0.11
99	0.14
100	0.17
101	0.16
102	0.16
103	0.19
104	0.19
105	0.19
106	0.19
107	0.18
108	0.17
109	0.18
110	0.21
111	0.2
112	0.25
113	0.28
114	0.31
115	0.38
116	0.4
117	0.4
118	0.37
119	0.37
120	0.32
121	0.26
122	0.25
123	0.18
124	0.14
125	0.18
126	0.2
127	0.25
128	0.29
129	0.35
130	0.33
131	0.35
132	0.35
133	0.3
134	0.29
135	0.24
136	0.2
137	0.13
138	0.12
139	0.12
140	0.12
141	0.11
142	0.08
143	0.07
144	0.09
145	0.09
146	0.1
147	0.16
148	0.17
149	0.17
150	0.18
151	0.19
152	0.17
153	0.18
154	0.17
155	0.08
156	0.09
157	0.09
158	0.08
159	0.08
160	0.09
161	0.11
162	0.13
163	0.16
164	0.15
165	0.15
166	0.17
167	0.21
168	0.19
169	0.21
170	0.21
171	0.19
172	0.19
173	0.18
174	0.17
175	0.14
176	0.16
177	0.12
178	0.1
179	0.1
180	0.1
181	0.12
182	0.11
183	0.11
184	0.08
185	0.08
186	0.07
187	0.07
188	0.07
189	0.06
190	0.07
191	0.06
192	0.07
193	0.07
194	0.08
195	0.08
196	0.1
197	0.11
198	0.12
199	0.17
200	0.21
201	0.25
202	0.27
203	0.28
204	0.26
205	0.31
206	0.35
207	0.38
208	0.41
209	0.38
210	0.35
211	0.38
212	0.42
213	0.38
214	0.41
215	0.42
216	0.41
217	0.47
218	0.52
219	0.52
220	0.54
221	0.52
222	0.46
223	0.41
224	0.39
225	0.39
226	0.34
227	0.32
228	0.26
229	0.29
230	0.27
231	0.24
232	0.18
233	0.12
234	0.12
235	0.12
236	0.12
237	0.14
238	0.19
239	0.23
240	0.32
241	0.35
242	0.43
243	0.44
244	0.44
245	0.43
246	0.44
247	0.42
248	0.34
249	0.31
250	0.21
251	0.21
252	0.2
253	0.14
254	0.08
255	0.05
256	0.04
257	0.04
258	0.04
259	0.04
260	0.04
261	0.06
262	0.07
263	0.06
264	0.06
265	0.06
266	0.06
267	0.06
268	0.06
269	0.05
270	0.05
271	0.06
272	0.07
273	0.07
274	0.07
275	0.07
276	0.08
277	0.08
278	0.08
279	0.08
280	0.07
281	0.11
282	0.12
283	0.12
284	0.12
285	0.13
286	0.12
287	0.13
288	0.14
289	0.11
290	0.12
291	0.12
292	0.13
293	0.12
294	0.15
295	0.13
296	0.13
297	0.13
298	0.14
299	0.16
300	0.15
301	0.16
302	0.14
303	0.15
304	0.14
305	0.19
306	0.19
307	0.19
308	0.28
309	0.27
310	0.27
311	0.28
312	0.36
313	0.32
314	0.32
315	0.3
316	0.25
317	0.24
318	0.23
319	0.25
320	0.17
321	0.17
322	0.14
323	0.14
324	0.11
325	0.11
326	0.12
327	0.08
328	0.08
329	0.08
330	0.09
331	0.09
332	0.08
333	0.1
334	0.09
335	0.1
336	0.12
337	0.13
338	0.16
339	0.2
340	0.22
341	0.28
342	0.33
343	0.33
344	0.39
345	0.41
346	0.39
347	0.37
348	0.36
349	0.29
350	0.24
351	0.24
352	0.19
353	0.14
354	0.13
355	0.1
356	0.1
357	0.09
358	0.09
359	0.1
360	0.08
361	0.09
362	0.1
363	0.1
364	0.12
365	0.14
366	0.19
367	0.22
368	0.23
369	0.23
370	0.26
371	0.27
372	0.24
373	0.27
374	0.26
375	0.25
376	0.27
377	0.27
378	0.28
379	0.26
380	0.28
381	0.24
382	0.22
383	0.19
384	0.17
385	0.2
386	0.17
387	0.2
388	0.21
389	0.21
390	0.19
391	0.18
392	0.2
393	0.17
394	0.21
395	0.26
396	0.27
397	0.28
398	0.36
399	0.37
400	0.36
401	0.42
402	0.45
403	0.48
404	0.51
405	0.54
406	0.49
407	0.49
408	0.52
409	0.47
410	0.46
411	0.4
412	0.34
413	0.3
414	0.28
415	0.27
416	0.24
417	0.22
418	0.17
419	0.13
420	0.11
421	0.11
422	0.09
423	0.11
424	0.12
425	0.12
426	0.12
427	0.15
428	0.2
429	0.21
430	0.23
431	0.26
432	0.34
433	0.37
434	0.42
435	0.38
436	0.39
437	0.4
438	0.4
439	0.37
440	0.35
441	0.34
442	0.33
443	0.39
444	0.37
445	0.38
446	0.41
447	0.45
448	0.46
449	0.49

A0A075AU66

3D AlphaFold-predicted Structure Viewer