FuNGI

A0A075ASQ4

Protein Details

Accession

A0A075ASQ4

Localization Confidence

Low

Confidence Score

7.8

NoLS Segment(s)

Position	Sequence	Protein Nature
139-162	WNPEQKYSFKNKRPAKPQSLRIYE	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto_nucl 11, nucl 10, cyto 10, cysk 3, pero 2

Family & Domain DBs

InterPro	View protein in InterPro IPR006047 Glyco_hydro_13_cat_dom IPR004193 Glyco_hydro_13_N IPR017853 Glycoside_hydrolase_SF IPR014756 Ig_E-set
Gene Ontology	GO:0004553 F:hydrolase activity, hydrolyzing O-glycosyl compounds GO:0005978 P:glycogen biosynthetic process
Pfam	View protein in Pfam PF00128 Alpha-amylase PF02922 CBM_48

Amino Acid Sequences

MTAVELEVVCQDPYLKPHSGVLERRQNFFNDWVHKIEQHGHGLDKFSRGYKYYGFNVQPDNSVIYREWAPGVTRAYLIGDFNILFVYYYYLKFVILNCQSHPMKRDDFGVWEINVPAENGKCAIPHNSKVKTDESGIFWNPEQKYSFKNKRPAKPQSLRIYEAHVGICTPKAGISTYNDFTREVLPRIKKQGYNCIQLMAIMEHAYYASFGYQVTNFYACSSRFGTPEELMELIDTAHEYGLYVLLDIVHSHSSKNVLDGLNEFDGTDHCYFHEGGRGRHDLWDSRLFNYNHWEVLRFLLSNLRFYMEVYQFDGFRFDGVTSMLYHHHGINFGFSGDYREYFGEFVDDEAVNYLKLANFMIHKFYPFSITIAEDVSGMPTLCRPVEEGGVGFDYRLSMAXLNLSVISFSDTVGNVIAGLFGTFCFEVKNLEEGFTNWAIVMGEN

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.21
2	0.22
3	0.22
4	0.26
5	0.33
6	0.39
7	0.45
8	0.5
9	0.56
10	0.56
11	0.59
12	0.58
13	0.54
14	0.49
15	0.48
16	0.46
17	0.42
18	0.43
19	0.44
20	0.44
21	0.43
22	0.42
23	0.43
24	0.4
25	0.39
26	0.38
27	0.36
28	0.35
29	0.39
30	0.38
31	0.34
32	0.31
33	0.29
34	0.3
35	0.28
36	0.3
37	0.3
38	0.34
39	0.35
40	0.41
41	0.4
42	0.41
43	0.44
44	0.42
45	0.4
46	0.36
47	0.35
48	0.27
49	0.26
50	0.23
51	0.2
52	0.21
53	0.2
54	0.19
55	0.16
56	0.18
57	0.2
58	0.22
59	0.19
60	0.18
61	0.17
62	0.18
63	0.18
64	0.17
65	0.13
66	0.12
67	0.1
68	0.1
69	0.1
70	0.08
71	0.07
72	0.07
73	0.1
74	0.1
75	0.1
76	0.12
77	0.12
78	0.12
79	0.13
80	0.14
81	0.2
82	0.24
83	0.25
84	0.25
85	0.33
86	0.34
87	0.36
88	0.39
89	0.35
90	0.33
91	0.32
92	0.35
93	0.28
94	0.3
95	0.31
96	0.3
97	0.25
98	0.23
99	0.22
100	0.19
101	0.17
102	0.14
103	0.13
104	0.09
105	0.09
106	0.09
107	0.09
108	0.1
109	0.11
110	0.19
111	0.22
112	0.28
113	0.36
114	0.39
115	0.42
116	0.44
117	0.45
118	0.39
119	0.38
120	0.34
121	0.29
122	0.3
123	0.28
124	0.27
125	0.25
126	0.29
127	0.26
128	0.26
129	0.25
130	0.22
131	0.27
132	0.36
133	0.45
134	0.46
135	0.56
136	0.62
137	0.69
138	0.77
139	0.81
140	0.81
141	0.8
142	0.81
143	0.81
144	0.77
145	0.72
146	0.63
147	0.58
148	0.49
149	0.42
150	0.33
151	0.23
152	0.18
153	0.15
154	0.15
155	0.09
156	0.07
157	0.06
158	0.06
159	0.07
160	0.09
161	0.12
162	0.16
163	0.18
164	0.2
165	0.2
166	0.2
167	0.2
168	0.22
169	0.2
170	0.18
171	0.23
172	0.26
173	0.29
174	0.36
175	0.4
176	0.39
177	0.4
178	0.48
179	0.46
180	0.48
181	0.44
182	0.38
183	0.33
184	0.3
185	0.28
186	0.18
187	0.12
188	0.07
189	0.06
190	0.05
191	0.05
192	0.05
193	0.04
194	0.04
195	0.03
196	0.03
197	0.04
198	0.05
199	0.05
200	0.06
201	0.07
202	0.07
203	0.07
204	0.08
205	0.11
206	0.1
207	0.12
208	0.14
209	0.15
210	0.15
211	0.17
212	0.18
213	0.16
214	0.17
215	0.15
216	0.12
217	0.11
218	0.1
219	0.08
220	0.05
221	0.05
222	0.04
223	0.03
224	0.03
225	0.03
226	0.03
227	0.03
228	0.04
229	0.04
230	0.04
231	0.03
232	0.04
233	0.04
234	0.04
235	0.05
236	0.06
237	0.07
238	0.07
239	0.08
240	0.1
241	0.1
242	0.11
243	0.13
244	0.12
245	0.12
246	0.14
247	0.16
248	0.14
249	0.14
250	0.13
251	0.09
252	0.09
253	0.13
254	0.12
255	0.09
256	0.09
257	0.11
258	0.11
259	0.11
260	0.18
261	0.16
262	0.18
263	0.23
264	0.26
265	0.24
266	0.27
267	0.29
268	0.24
269	0.27
270	0.34
271	0.3
272	0.3
273	0.37
274	0.34
275	0.34
276	0.37
277	0.34
278	0.27
279	0.26
280	0.25
281	0.18
282	0.2
283	0.2
284	0.14
285	0.13
286	0.17
287	0.17
288	0.18
289	0.18
290	0.17
291	0.15
292	0.16
293	0.22
294	0.18
295	0.19
296	0.19
297	0.2
298	0.19
299	0.19
300	0.2
301	0.13
302	0.11
303	0.11
304	0.08
305	0.08
306	0.08
307	0.09
308	0.08
309	0.09
310	0.1
311	0.12
312	0.13
313	0.13
314	0.13
315	0.14
316	0.14
317	0.14
318	0.13
319	0.12
320	0.11
321	0.1
322	0.13
323	0.13
324	0.13
325	0.13
326	0.13
327	0.14
328	0.14
329	0.14
330	0.11
331	0.1
332	0.1
333	0.11
334	0.1
335	0.09
336	0.11
337	0.11
338	0.09
339	0.09
340	0.09
341	0.07
342	0.08
343	0.08
344	0.09
345	0.12
346	0.13
347	0.19
348	0.19
349	0.2
350	0.21
351	0.21
352	0.23
353	0.21
354	0.21
355	0.17
356	0.17
357	0.17
358	0.16
359	0.15
360	0.11
361	0.11
362	0.11
363	0.1
364	0.09
365	0.08
366	0.08
367	0.11
368	0.11
369	0.11
370	0.12
371	0.13
372	0.15
373	0.16
374	0.16
375	0.15
376	0.17
377	0.17
378	0.14
379	0.12
380	0.11
381	0.09
382	0.1
383	0.08
384	0.07
385	0.07
386	0.09
387	0.09
388	0.09
389	0.09
390	0.08
391	0.08
392	0.1
393	0.09
394	0.09
395	0.11
396	0.11
397	0.11
398	0.12
399	0.11
400	0.08
401	0.08
402	0.08
403	0.06
404	0.05
405	0.05
406	0.04
407	0.07
408	0.07
409	0.08
410	0.09
411	0.09
412	0.12
413	0.15
414	0.2
415	0.18
416	0.19
417	0.2
418	0.2
419	0.25
420	0.23
421	0.21
422	0.15
423	0.15

A0A075ASQ4

3D AlphaFold-predicted Structure Viewer