Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075B2U8

Protein Details
Accession A0A075B2U8    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
100-123RILPRETRKSRSKQPRPRNRTLAAHydrophilic
NLS Segment(s)
PositionSequence
102-117LPRETRKSRSKQPRPR
Subcellular Location(s) cyto 17.5, cyto_nucl 13.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
Amino Acid Sequences MASALTKIIKPVGEQPDALEVKIAEALIDLENSSDEIRKELRPVQITSAKEIELGHGRKAIAVFVPVPLIKQVHKVQSRVVRELEKKFSDRHVIIIAQRRILPRETRKSRSKQPRPRNRTLAAVHDAILDDLVYPAEIIGKRLRVKVDGSRQIKVFLDRKDMESVEYKVDTFSSVYKKLTGKEVVFDFPAAQMAKEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.37
4 0.36
5 0.34
6 0.27
7 0.2
8 0.18
9 0.19
10 0.17
11 0.08
12 0.07
13 0.09
14 0.08
15 0.08
16 0.07
17 0.06
18 0.07
19 0.08
20 0.08
21 0.09
22 0.09
23 0.11
24 0.14
25 0.15
26 0.19
27 0.24
28 0.3
29 0.32
30 0.33
31 0.38
32 0.41
33 0.41
34 0.41
35 0.37
36 0.3
37 0.27
38 0.26
39 0.21
40 0.23
41 0.24
42 0.21
43 0.21
44 0.21
45 0.21
46 0.21
47 0.19
48 0.12
49 0.12
50 0.11
51 0.09
52 0.1
53 0.09
54 0.09
55 0.1
56 0.11
57 0.1
58 0.16
59 0.19
60 0.26
61 0.29
62 0.3
63 0.34
64 0.41
65 0.44
66 0.41
67 0.4
68 0.38
69 0.4
70 0.43
71 0.43
72 0.38
73 0.36
74 0.35
75 0.35
76 0.35
77 0.3
78 0.27
79 0.23
80 0.21
81 0.23
82 0.31
83 0.29
84 0.24
85 0.26
86 0.25
87 0.24
88 0.26
89 0.29
90 0.29
91 0.38
92 0.44
93 0.5
94 0.57
95 0.62
96 0.69
97 0.74
98 0.77
99 0.77
100 0.81
101 0.85
102 0.86
103 0.89
104 0.86
105 0.77
106 0.74
107 0.65
108 0.61
109 0.53
110 0.44
111 0.35
112 0.28
113 0.25
114 0.17
115 0.15
116 0.09
117 0.05
118 0.04
119 0.04
120 0.03
121 0.03
122 0.03
123 0.07
124 0.07
125 0.09
126 0.11
127 0.17
128 0.19
129 0.22
130 0.24
131 0.23
132 0.27
133 0.33
134 0.41
135 0.46
136 0.47
137 0.48
138 0.47
139 0.48
140 0.45
141 0.44
142 0.4
143 0.33
144 0.38
145 0.36
146 0.38
147 0.4
148 0.39
149 0.34
150 0.33
151 0.31
152 0.27
153 0.26
154 0.23
155 0.19
156 0.19
157 0.17
158 0.14
159 0.17
160 0.19
161 0.22
162 0.23
163 0.28
164 0.3
165 0.31
166 0.37
167 0.39
168 0.34
169 0.37
170 0.39
171 0.37
172 0.35
173 0.34
174 0.27
175 0.21
176 0.24
177 0.19