Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AP15

Protein Details
Accession A0A075AP15   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-29AKPPSRPSLVPKKAEKPQLPHydrophilic
NLS Segment(s)
PositionSequence
82-86RSKKA
Subcellular Location(s) nucl 11.5, cyto_nucl 10, cyto 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR033701  POLO_box_1  
IPR033695  POLO_box_2  
IPR000959  POLO_box_dom  
IPR036947  POLO_box_dom_sf  
IPR000719  Prot_kinase_dom  
IPR017441  Protein_kinase_ATP_BS  
IPR008271  Ser/Thr_kinase_AS  
Gene Ontology GO:0005935  C:cellular bud neck  
GO:0000776  C:kinetochore  
GO:0090619  C:meiotic spindle pole  
GO:0035974  C:meiotic spindle pole body  
GO:1990023  C:mitotic spindle midzone  
GO:0044732  C:mitotic spindle pole body  
GO:0140602  C:nucleolar ring  
GO:0005524  F:ATP binding  
GO:0019237  F:centromeric DNA binding  
GO:0051219  F:phosphoprotein binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0044877  F:protein-containing complex binding  
GO:0010458  P:exit from mitosis  
GO:0035556  P:intracellular signal transduction  
GO:1990571  P:meiotic centromere clustering  
GO:1990813  P:meiotic centromeric cohesion protection  
GO:0090306  P:meiotic spindle assembly  
GO:1904750  P:negative regulation of protein localization to nucleolus  
GO:0045793  P:positive regulation of cell size  
GO:0010971  P:positive regulation of G2/M transition of mitotic cell cycle  
GO:0140281  P:positive regulation of mitotic division septum assembly  
GO:0045842  P:positive regulation of mitotic metaphase/anaphase transition  
GO:0140429  P:positive regulation of mitotic sister chromatid biorientation  
GO:0010696  P:positive regulation of mitotic spindle pole body separation  
GO:0046827  P:positive regulation of protein export from nucleus  
GO:0110083  P:positive regulation of protein localization to cell division site involved in mitotic actomyosin contractile ring assembly  
GO:0140434  P:positive regulation of protein localization to meiotic spindle pole body  
GO:0035025  P:positive regulation of Rho protein signal transduction  
GO:0031031  P:positive regulation of septation initiation signaling  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0006468  P:protein phosphorylation  
GO:1903353  P:regulation of nucleus organization  
GO:1902542  P:regulation of protein localization to mitotic spindle pole body  
GO:0000712  P:resolution of meiotic recombination intermediates  
GO:0070194  P:synaptonemal complex disassembly  
Pfam View protein in Pfam  
PF00069  Pkinase  
PF00659  POLO_box  
PROSITE View protein in PROSITE  
PS50078  POLO_BOX  
PS00107  PROTEIN_KINASE_ATP  
PS50011  PROTEIN_KINASE_DOM  
PS00108  PROTEIN_KINASE_ST  
CDD cd13118  POLO_box_1  
cd13117  POLO_box_2  
cd14099  STKc_PLK  
Amino Acid Sequences MTVPSTSHSAKPPSRPSLVPKKAEKPQLPSVPLHLVDKRDNDIQYIRGPLLGEGGFARCYYVTCCTSQKAFAAKAVPKIGLRSKKAKDKLLSEIKLHRELIHENIVKFIRAFEDDNFVYIILELCENKTCVELLKEKKRLSEPEAKMFFPQILGALQCMHDARIIHRDLKLGNLFIAKDGEIKIGDFGLATKVNDKGERKKTICGTPNYIAPEILFNNDVGHSYEVDIWSLGVILYTMLIGKPPFQTKHIKEIYEKIKNTDYTFPDDCPISAEAKDLIEKLLSQNPKDRPTIMQILEHPFMRMRERIAALTDITNTTKCKENIHKEFQKLNIKDQKGPLKDNDNYRAKAKPQIQQIPLNLQNAKNDINYNLLAQQDTPKKVTSPKRTTSLVDSVHKCIKVVLRGNCEYLPSFKELKLPDAFITKWIDYTMKYGFVYSLSNGIEGMLFNDHTTLLLHSPTNRMHYFDLDNYKRCSFDASTKNEERDLEKKKGVLLAMKGYMSNNLNHAANITINCAEKFPSIYLTKYMKADGATLFRLSNRSIQVNFQDHTKLVFSNEGLIVTFIDSQRNLSVLNIKDIVLNNHIQIIEKLERVLKIFDDLQSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.63
3 0.66
4 0.68
5 0.71
6 0.7
7 0.7
8 0.71
9 0.74
10 0.8
11 0.77
12 0.73
13 0.74
14 0.75
15 0.7
16 0.63
17 0.6
18 0.56
19 0.51
20 0.49
21 0.42
22 0.39
23 0.4
24 0.42
25 0.42
26 0.41
27 0.4
28 0.39
29 0.38
30 0.36
31 0.34
32 0.33
33 0.29
34 0.25
35 0.25
36 0.21
37 0.22
38 0.18
39 0.16
40 0.13
41 0.15
42 0.14
43 0.13
44 0.14
45 0.1
46 0.11
47 0.13
48 0.18
49 0.19
50 0.22
51 0.26
52 0.28
53 0.31
54 0.32
55 0.34
56 0.34
57 0.33
58 0.34
59 0.38
60 0.38
61 0.42
62 0.42
63 0.39
64 0.34
65 0.38
66 0.43
67 0.45
68 0.47
69 0.51
70 0.56
71 0.64
72 0.7
73 0.73
74 0.7
75 0.67
76 0.71
77 0.72
78 0.68
79 0.63
80 0.63
81 0.6
82 0.59
83 0.55
84 0.46
85 0.39
86 0.37
87 0.37
88 0.39
89 0.37
90 0.32
91 0.36
92 0.35
93 0.33
94 0.3
95 0.26
96 0.19
97 0.18
98 0.2
99 0.16
100 0.22
101 0.21
102 0.22
103 0.22
104 0.19
105 0.16
106 0.14
107 0.13
108 0.07
109 0.08
110 0.08
111 0.09
112 0.11
113 0.11
114 0.12
115 0.12
116 0.11
117 0.12
118 0.16
119 0.23
120 0.3
121 0.4
122 0.47
123 0.48
124 0.54
125 0.58
126 0.59
127 0.58
128 0.6
129 0.55
130 0.57
131 0.59
132 0.54
133 0.49
134 0.44
135 0.37
136 0.26
137 0.21
138 0.12
139 0.1
140 0.09
141 0.09
142 0.09
143 0.09
144 0.1
145 0.1
146 0.09
147 0.1
148 0.11
149 0.12
150 0.18
151 0.21
152 0.22
153 0.23
154 0.25
155 0.23
156 0.28
157 0.28
158 0.21
159 0.2
160 0.19
161 0.18
162 0.17
163 0.18
164 0.12
165 0.12
166 0.12
167 0.12
168 0.1
169 0.1
170 0.1
171 0.09
172 0.08
173 0.07
174 0.06
175 0.08
176 0.09
177 0.09
178 0.1
179 0.13
180 0.15
181 0.2
182 0.24
183 0.3
184 0.38
185 0.47
186 0.47
187 0.51
188 0.54
189 0.58
190 0.61
191 0.56
192 0.54
193 0.47
194 0.49
195 0.46
196 0.42
197 0.33
198 0.26
199 0.24
200 0.17
201 0.17
202 0.13
203 0.1
204 0.1
205 0.1
206 0.11
207 0.09
208 0.1
209 0.09
210 0.09
211 0.11
212 0.1
213 0.1
214 0.09
215 0.07
216 0.06
217 0.06
218 0.05
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.04
227 0.04
228 0.06
229 0.09
230 0.13
231 0.15
232 0.19
233 0.28
234 0.3
235 0.4
236 0.42
237 0.41
238 0.39
239 0.46
240 0.51
241 0.5
242 0.48
243 0.41
244 0.42
245 0.41
246 0.42
247 0.4
248 0.33
249 0.31
250 0.32
251 0.3
252 0.26
253 0.25
254 0.22
255 0.18
256 0.17
257 0.12
258 0.11
259 0.11
260 0.1
261 0.11
262 0.11
263 0.09
264 0.08
265 0.07
266 0.07
267 0.08
268 0.13
269 0.15
270 0.15
271 0.22
272 0.26
273 0.3
274 0.31
275 0.3
276 0.26
277 0.29
278 0.34
279 0.28
280 0.26
281 0.25
282 0.28
283 0.28
284 0.26
285 0.22
286 0.17
287 0.17
288 0.17
289 0.15
290 0.12
291 0.14
292 0.15
293 0.16
294 0.16
295 0.15
296 0.14
297 0.13
298 0.12
299 0.1
300 0.1
301 0.1
302 0.1
303 0.1
304 0.16
305 0.16
306 0.21
307 0.29
308 0.38
309 0.44
310 0.54
311 0.58
312 0.56
313 0.59
314 0.6
315 0.61
316 0.53
317 0.54
318 0.52
319 0.49
320 0.49
321 0.51
322 0.52
323 0.46
324 0.47
325 0.42
326 0.41
327 0.42
328 0.45
329 0.48
330 0.45
331 0.44
332 0.43
333 0.43
334 0.38
335 0.42
336 0.42
337 0.38
338 0.41
339 0.48
340 0.5
341 0.51
342 0.51
343 0.5
344 0.48
345 0.45
346 0.38
347 0.31
348 0.29
349 0.26
350 0.26
351 0.2
352 0.18
353 0.15
354 0.16
355 0.15
356 0.14
357 0.14
358 0.13
359 0.12
360 0.12
361 0.18
362 0.2
363 0.22
364 0.23
365 0.22
366 0.23
367 0.31
368 0.4
369 0.45
370 0.48
371 0.51
372 0.54
373 0.56
374 0.56
375 0.53
376 0.51
377 0.45
378 0.43
379 0.41
380 0.4
381 0.42
382 0.4
383 0.35
384 0.3
385 0.29
386 0.29
387 0.34
388 0.35
389 0.38
390 0.4
391 0.42
392 0.4
393 0.38
394 0.32
395 0.27
396 0.23
397 0.2
398 0.2
399 0.19
400 0.24
401 0.23
402 0.28
403 0.27
404 0.27
405 0.24
406 0.25
407 0.25
408 0.22
409 0.25
410 0.2
411 0.19
412 0.18
413 0.18
414 0.15
415 0.18
416 0.17
417 0.15
418 0.15
419 0.15
420 0.14
421 0.14
422 0.15
423 0.12
424 0.14
425 0.12
426 0.12
427 0.11
428 0.11
429 0.1
430 0.09
431 0.1
432 0.07
433 0.07
434 0.07
435 0.07
436 0.07
437 0.07
438 0.08
439 0.08
440 0.08
441 0.09
442 0.1
443 0.12
444 0.16
445 0.18
446 0.24
447 0.23
448 0.25
449 0.25
450 0.28
451 0.3
452 0.31
453 0.39
454 0.38
455 0.42
456 0.43
457 0.43
458 0.4
459 0.36
460 0.36
461 0.28
462 0.33
463 0.37
464 0.4
465 0.47
466 0.51
467 0.53
468 0.5
469 0.49
470 0.44
471 0.44
472 0.44
473 0.42
474 0.41
475 0.4
476 0.4
477 0.41
478 0.39
479 0.35
480 0.31
481 0.3
482 0.3
483 0.29
484 0.27
485 0.24
486 0.27
487 0.24
488 0.22
489 0.19
490 0.19
491 0.19
492 0.19
493 0.19
494 0.15
495 0.16
496 0.15
497 0.15
498 0.15
499 0.16
500 0.16
501 0.16
502 0.17
503 0.16
504 0.18
505 0.16
506 0.2
507 0.2
508 0.21
509 0.28
510 0.3
511 0.32
512 0.32
513 0.32
514 0.28
515 0.26
516 0.28
517 0.24
518 0.24
519 0.23
520 0.23
521 0.22
522 0.22
523 0.24
524 0.23
525 0.25
526 0.25
527 0.28
528 0.28
529 0.33
530 0.39
531 0.42
532 0.41
533 0.38
534 0.36
535 0.32
536 0.33
537 0.29
538 0.23
539 0.19
540 0.22
541 0.19
542 0.21
543 0.21
544 0.19
545 0.17
546 0.17
547 0.15
548 0.13
549 0.16
550 0.12
551 0.16
552 0.15
553 0.17
554 0.18
555 0.18
556 0.17
557 0.16
558 0.23
559 0.21
560 0.27
561 0.25
562 0.25
563 0.28
564 0.3
565 0.31
566 0.28
567 0.28
568 0.23
569 0.25
570 0.25
571 0.23
572 0.22
573 0.25
574 0.24
575 0.23
576 0.25
577 0.25
578 0.27
579 0.28
580 0.29
581 0.23
582 0.24
583 0.26