FuNGI

A0A075AP15

Protein Details

Accession

A0A075AP15

Localization Confidence

Medium

Confidence Score

11.2

NoLS Segment(s)

Position	Sequence	Protein Nature
10-29	AKPPSRPSLVPKKAEKPQLP	Hydrophilic

NLS Segment(s)

Position	Sequence
82-86	RSKKA

Subcellular Location(s)

nucl 11.5, cyto_nucl 10, cyto 7.5, mito 7

Family & Domain DBs

InterPro	View protein in InterPro IPR011009 Kinase-like_dom_sf IPR033701 POLO_box_1 IPR033695 POLO_box_2 IPR000959 POLO_box_dom IPR036947 POLO_box_dom_sf IPR000719 Prot_kinase_dom IPR017441 Protein_kinase_ATP_BS IPR008271 Ser/Thr_kinase_AS
Gene Ontology	GO:0005935 C:cellular bud neck GO:0000776 C:kinetochore GO:0090619 C:meiotic spindle pole GO:0035974 C:meiotic spindle pole body GO:1990023 C:mitotic spindle midzone GO:0044732 C:mitotic spindle pole body GO:0140602 C:nucleolar ring GO:0005524 F:ATP binding GO:0019237 F:centromeric DNA binding GO:0051219 F:phosphoprotein binding GO:0004674 F:protein serine/threonine kinase activity GO:0044877 F:protein-containing complex binding GO:0010458 P:exit from mitosis GO:0035556 P:intracellular signal transduction GO:1990571 P:meiotic centromere clustering GO:1990813 P:meiotic centromeric cohesion protection GO:0090306 P:meiotic spindle assembly GO:1904750 P:negative regulation of protein localization to nucleolus GO:0045793 P:positive regulation of cell size GO:0010971 P:positive regulation of G2/M transition of mitotic cell cycle GO:0140281 P:positive regulation of mitotic division septum assembly GO:0045842 P:positive regulation of mitotic metaphase/anaphase transition GO:0140429 P:positive regulation of mitotic sister chromatid biorientation GO:0010696 P:positive regulation of mitotic spindle pole body separation GO:0046827 P:positive regulation of protein export from nucleus GO:0110083 P:positive regulation of protein localization to cell division site involved in mitotic actomyosin contractile ring assembly GO:0140434 P:positive regulation of protein localization to meiotic spindle pole body GO:0035025 P:positive regulation of Rho protein signal transduction GO:0031031 P:positive regulation of septation initiation signaling GO:0045944 P:positive regulation of transcription by RNA polymerase II GO:0006468 P:protein phosphorylation GO:1903353 P:regulation of nucleus organization GO:1902542 P:regulation of protein localization to mitotic spindle pole body GO:0000712 P:resolution of meiotic recombination intermediates GO:0070194 P:synaptonemal complex disassembly
Pfam	View protein in Pfam PF00069 Pkinase PF00659 POLO_box
PROSITE	View protein in PROSITE PS50078 POLO_BOX PS00107 PROTEIN_KINASE_ATP PS50011 PROTEIN_KINASE_DOM PS00108 PROTEIN_KINASE_ST
CDD	cd13118 POLO_box_1 cd13117 POLO_box_2 cd14099 STKc_PLK

Amino Acid Sequences

MTVPSTSHSAKPPSRPSLVPKKAEKPQLPSVPLHLVDKRDNDIQYIRGPLLGEGGFARCYYVTCCTSQKAFAAKAVPKIGLRSKKAKDKLLSEIKLHRELIHENIVKFIRAFEDDNFVYIILELCENKTCVELLKEKKRLSEPEAKMFFPQILGALQCMHDARIIHRDLKLGNLFIAKDGEIKIGDFGLATKVNDKGERKKTICGTPNYIAPEILFNNDVGHSYEVDIWSLGVILYTMLIGKPPFQTKHIKEIYEKIKNTDYTFPDDCPISAEAKDLIEKLLSQNPKDRPTIMQILEHPFMRMRERIAALTDITNTTKCKENIHKEFQKLNIKDQKGPLKDNDNYRAKAKPQIQQIPLNLQNAKNDINYNLLAQQDTPKKVTSPKRTTSLVDSVHKCIKVVLRGNCEYLPSFKELKLPDAFITKWIDYTMKYGFVYSLSNGIEGMLFNDHTTLLLHSPTNRMHYFDLDNYKRCSFDASTKNEERDLEKKKGVLLAMKGYMSNNLNHAANITINCAEKFPSIYLTKYMKADGATLFRLSNRSIQVNFQDHTKLVFSNEGLIVTFIDSQRNLSVLNIKDIVLNNHIQIIEKLERVLKIFDDLQSK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.62
2	0.63
3	0.66
4	0.68
5	0.71
6	0.7
7	0.7
8	0.71
9	0.74
10	0.8
11	0.77
12	0.73
13	0.74
14	0.75
15	0.7
16	0.63
17	0.6
18	0.56
19	0.51
20	0.49
21	0.42
22	0.39
23	0.4
24	0.42
25	0.42
26	0.41
27	0.4
28	0.39
29	0.38
30	0.36
31	0.34
32	0.33
33	0.29
34	0.25
35	0.25
36	0.21
37	0.22
38	0.18
39	0.16
40	0.13
41	0.15
42	0.14
43	0.13
44	0.14
45	0.1
46	0.11
47	0.13
48	0.18
49	0.19
50	0.22
51	0.26
52	0.28
53	0.31
54	0.32
55	0.34
56	0.34
57	0.33
58	0.34
59	0.38
60	0.38
61	0.42
62	0.42
63	0.39
64	0.34
65	0.38
66	0.43
67	0.45
68	0.47
69	0.51
70	0.56
71	0.64
72	0.7
73	0.73
74	0.7
75	0.67
76	0.71
77	0.72
78	0.68
79	0.63
80	0.63
81	0.6
82	0.59
83	0.55
84	0.46
85	0.39
86	0.37
87	0.37
88	0.39
89	0.37
90	0.32
91	0.36
92	0.35
93	0.33
94	0.3
95	0.26
96	0.19
97	0.18
98	0.2
99	0.16
100	0.22
101	0.21
102	0.22
103	0.22
104	0.19
105	0.16
106	0.14
107	0.13
108	0.07
109	0.08
110	0.08
111	0.09
112	0.11
113	0.11
114	0.12
115	0.12
116	0.11
117	0.12
118	0.16
119	0.23
120	0.3
121	0.4
122	0.47
123	0.48
124	0.54
125	0.58
126	0.59
127	0.58
128	0.6
129	0.55
130	0.57
131	0.59
132	0.54
133	0.49
134	0.44
135	0.37
136	0.26
137	0.21
138	0.12
139	0.1
140	0.09
141	0.09
142	0.09
143	0.09
144	0.1
145	0.1
146	0.09
147	0.1
148	0.11
149	0.12
150	0.18
151	0.21
152	0.22
153	0.23
154	0.25
155	0.23
156	0.28
157	0.28
158	0.21
159	0.2
160	0.19
161	0.18
162	0.17
163	0.18
164	0.12
165	0.12
166	0.12
167	0.12
168	0.1
169	0.1
170	0.1
171	0.09
172	0.08
173	0.07
174	0.06
175	0.08
176	0.09
177	0.09
178	0.1
179	0.13
180	0.15
181	0.2
182	0.24
183	0.3
184	0.38
185	0.47
186	0.47
187	0.51
188	0.54
189	0.58
190	0.61
191	0.56
192	0.54
193	0.47
194	0.49
195	0.46
196	0.42
197	0.33
198	0.26
199	0.24
200	0.17
201	0.17
202	0.13
203	0.1
204	0.1
205	0.1
206	0.11
207	0.09
208	0.1
209	0.09
210	0.09
211	0.11
212	0.1
213	0.1
214	0.09
215	0.07
216	0.06
217	0.06
218	0.05
219	0.03
220	0.03
221	0.03
222	0.03
223	0.03
224	0.03
225	0.03
226	0.04
227	0.04
228	0.06
229	0.09
230	0.13
231	0.15
232	0.19
233	0.28
234	0.3
235	0.4
236	0.42
237	0.41
238	0.39
239	0.46
240	0.51
241	0.5
242	0.48
243	0.41
244	0.42
245	0.41
246	0.42
247	0.4
248	0.33
249	0.31
250	0.32
251	0.3
252	0.26
253	0.25
254	0.22
255	0.18
256	0.17
257	0.12
258	0.11
259	0.11
260	0.1
261	0.11
262	0.11
263	0.09
264	0.08
265	0.07
266	0.07
267	0.08
268	0.13
269	0.15
270	0.15
271	0.22
272	0.26
273	0.3
274	0.31
275	0.3
276	0.26
277	0.29
278	0.34
279	0.28
280	0.26
281	0.25
282	0.28
283	0.28
284	0.26
285	0.22
286	0.17
287	0.17
288	0.17
289	0.15
290	0.12
291	0.14
292	0.15
293	0.16
294	0.16
295	0.15
296	0.14
297	0.13
298	0.12
299	0.1
300	0.1
301	0.1
302	0.1
303	0.1
304	0.16
305	0.16
306	0.21
307	0.29
308	0.38
309	0.44
310	0.54
311	0.58
312	0.56
313	0.59
314	0.6
315	0.61
316	0.53
317	0.54
318	0.52
319	0.49
320	0.49
321	0.51
322	0.52
323	0.46
324	0.47
325	0.42
326	0.41
327	0.42
328	0.45
329	0.48
330	0.45
331	0.44
332	0.43
333	0.43
334	0.38
335	0.42
336	0.42
337	0.38
338	0.41
339	0.48
340	0.5
341	0.51
342	0.51
343	0.5
344	0.48
345	0.45
346	0.38
347	0.31
348	0.29
349	0.26
350	0.26
351	0.2
352	0.18
353	0.15
354	0.16
355	0.15
356	0.14
357	0.14
358	0.13
359	0.12
360	0.12
361	0.18
362	0.2
363	0.22
364	0.23
365	0.22
366	0.23
367	0.31
368	0.4
369	0.45
370	0.48
371	0.51
372	0.54
373	0.56
374	0.56
375	0.53
376	0.51
377	0.45
378	0.43
379	0.41
380	0.4
381	0.42
382	0.4
383	0.35
384	0.3
385	0.29
386	0.29
387	0.34
388	0.35
389	0.38
390	0.4
391	0.42
392	0.4
393	0.38
394	0.32
395	0.27
396	0.23
397	0.2
398	0.2
399	0.19
400	0.24
401	0.23
402	0.28
403	0.27
404	0.27
405	0.24
406	0.25
407	0.25
408	0.22
409	0.25
410	0.2
411	0.19
412	0.18
413	0.18
414	0.15
415	0.18
416	0.17
417	0.15
418	0.15
419	0.15
420	0.14
421	0.14
422	0.15
423	0.12
424	0.14
425	0.12
426	0.12
427	0.11
428	0.11
429	0.1
430	0.09
431	0.1
432	0.07
433	0.07
434	0.07
435	0.07
436	0.07
437	0.07
438	0.08
439	0.08
440	0.08
441	0.09
442	0.1
443	0.12
444	0.16
445	0.18
446	0.24
447	0.23
448	0.25
449	0.25
450	0.28
451	0.3
452	0.31
453	0.39
454	0.38
455	0.42
456	0.43
457	0.43
458	0.4
459	0.36
460	0.36
461	0.28
462	0.33
463	0.37
464	0.4
465	0.47
466	0.51
467	0.53
468	0.5
469	0.49
470	0.44
471	0.44
472	0.44
473	0.42
474	0.41
475	0.4
476	0.4
477	0.41
478	0.39
479	0.35
480	0.31
481	0.3
482	0.3
483	0.29
484	0.27
485	0.24
486	0.27
487	0.24
488	0.22
489	0.19
490	0.19
491	0.19
492	0.19
493	0.19
494	0.15
495	0.16
496	0.15
497	0.15
498	0.15
499	0.16
500	0.16
501	0.16
502	0.17
503	0.16
504	0.18
505	0.16
506	0.2
507	0.2
508	0.21
509	0.28
510	0.3
511	0.32
512	0.32
513	0.32
514	0.28
515	0.26
516	0.28
517	0.24
518	0.24
519	0.23
520	0.23
521	0.22
522	0.22
523	0.24
524	0.23
525	0.25
526	0.25
527	0.28
528	0.28
529	0.33
530	0.39
531	0.42
532	0.41
533	0.38
534	0.36
535	0.32
536	0.33
537	0.29
538	0.23
539	0.19
540	0.22
541	0.19
542	0.21
543	0.21
544	0.19
545	0.17
546	0.17
547	0.15
548	0.13
549	0.16
550	0.12
551	0.16
552	0.15
553	0.17
554	0.18
555	0.18
556	0.17
557	0.16
558	0.23
559	0.21
560	0.27
561	0.25
562	0.25
563	0.28
564	0.3
565	0.31
566	0.28
567	0.28
568	0.23
569	0.25
570	0.25
571	0.23
572	0.22
573	0.25
574	0.24
575	0.23
576	0.25
577	0.25
578	0.27
579	0.28
580	0.29
581	0.23
582	0.24
583	0.26

A0A075AP15

3D AlphaFold-predicted Structure Viewer