Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AVW6

Protein Details
Accession A0A075AVW6    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
310-331MNTGRPVTPPRGKKKKEMAKVTHydrophilic
NLS Segment(s)
PositionSequence
318-327PPRGKKKKEM
Subcellular Location(s) nucl 12, cyto 11, pero 2, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004843  Calcineurin-like_PHP_ApaH  
IPR029052  Metallo-depent_PP-like  
IPR006186  Ser/Thr-sp_prot-phosphatase  
IPR031675  STPPase_N  
Gene Ontology GO:0032174  C:cellular bud neck septin collar  
GO:0000131  C:incipient cellular bud site  
GO:0000776  C:kinetochore  
GO:0001400  C:mating projection base  
GO:0005847  C:mRNA cleavage and polyadenylation specificity factor complex  
GO:0005730  C:nucleolus  
GO:0000164  C:protein phosphatase type 1 complex  
GO:0005816  C:spindle pole body  
GO:0017018  F:myosin phosphatase activity  
GO:0007059  P:chromosome segregation  
GO:0000077  P:DNA damage checkpoint signaling  
GO:0000076  P:DNA replication checkpoint signaling  
GO:0034221  P:fungal-type cell wall chitin biosynthetic process  
GO:0006873  P:intracellular monoatomic ion homeostasis  
GO:0051321  P:meiotic cell cycle  
GO:0007094  P:mitotic spindle assembly checkpoint signaling  
GO:0006378  P:mRNA polyadenylation  
GO:1905183  P:negative regulation of protein serine/threonine phosphatase activity  
GO:2000370  P:positive regulation of clathrin-dependent endocytosis  
GO:1903501  P:positive regulation of mitotic actomyosin contractile ring assembly  
GO:0098789  P:pre-mRNA cleavage required for polyadenylation  
GO:0034501  P:protein localization to kinetochore  
GO:0007116  P:regulation of cell budding  
GO:0008360  P:regulation of cell shape  
GO:0070873  P:regulation of glycogen metabolic process  
GO:1901901  P:regulation of protein localization to cell division site involved in cytokinesis  
GO:0031297  P:replication fork processing  
GO:0009408  P:response to heat  
GO:0006986  P:response to unfolded protein  
GO:0000723  P:telomere maintenance  
Pfam View protein in Pfam  
PF00149  Metallophos  
PF16891  STPPase_N  
PROSITE View protein in PROSITE  
PS00125  SER_THR_PHOSPHATASE  
CDD cd07414  MPP_PP1_PPKL  
Amino Acid Sequences MSAEPEVDVDSIIERLLEVRGSRPGKQVQLAEHEIRHLCVKSREIFMSQPTLLELDAPIKICGDIHGQYFDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPELQSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKEVTGWSENDRGVSFVFGPDVVTRFLQKHDMDLICRAHQVVEDGYEFYAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKQKYAYGGMNTGRPVTPPRGKKKKEMAKVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.08
4 0.1
5 0.1
6 0.12
7 0.22
8 0.25
9 0.29
10 0.35
11 0.4
12 0.42
13 0.47
14 0.48
15 0.44
16 0.48
17 0.51
18 0.48
19 0.43
20 0.43
21 0.38
22 0.35
23 0.35
24 0.29
25 0.27
26 0.29
27 0.33
28 0.33
29 0.37
30 0.38
31 0.37
32 0.38
33 0.36
34 0.37
35 0.32
36 0.27
37 0.23
38 0.21
39 0.18
40 0.16
41 0.13
42 0.09
43 0.11
44 0.12
45 0.11
46 0.11
47 0.11
48 0.11
49 0.12
50 0.14
51 0.14
52 0.15
53 0.16
54 0.16
55 0.17
56 0.17
57 0.16
58 0.13
59 0.11
60 0.1
61 0.09
62 0.09
63 0.1
64 0.11
65 0.11
66 0.12
67 0.13
68 0.12
69 0.12
70 0.14
71 0.13
72 0.12
73 0.12
74 0.11
75 0.1
76 0.1
77 0.1
78 0.08
79 0.09
80 0.09
81 0.11
82 0.1
83 0.1
84 0.1
85 0.1
86 0.13
87 0.13
88 0.14
89 0.14
90 0.14
91 0.14
92 0.13
93 0.13
94 0.11
95 0.12
96 0.11
97 0.13
98 0.16
99 0.18
100 0.2
101 0.24
102 0.26
103 0.28
104 0.27
105 0.25
106 0.27
107 0.26
108 0.28
109 0.26
110 0.26
111 0.22
112 0.22
113 0.22
114 0.18
115 0.22
116 0.18
117 0.16
118 0.13
119 0.13
120 0.13
121 0.13
122 0.14
123 0.12
124 0.19
125 0.22
126 0.24
127 0.27
128 0.29
129 0.34
130 0.37
131 0.43
132 0.45
133 0.5
134 0.57
135 0.57
136 0.59
137 0.59
138 0.56
139 0.52
140 0.48
141 0.4
142 0.32
143 0.3
144 0.25
145 0.2
146 0.19
147 0.14
148 0.09
149 0.08
150 0.07
151 0.05
152 0.05
153 0.06
154 0.05
155 0.05
156 0.04
157 0.04
158 0.04
159 0.04
160 0.05
161 0.07
162 0.07
163 0.07
164 0.08
165 0.08
166 0.08
167 0.08
168 0.07
169 0.08
170 0.1
171 0.12
172 0.13
173 0.14
174 0.16
175 0.19
176 0.19
177 0.19
178 0.21
179 0.23
180 0.26
181 0.26
182 0.24
183 0.23
184 0.23
185 0.21
186 0.18
187 0.13
188 0.07
189 0.07
190 0.07
191 0.06
192 0.06
193 0.07
194 0.08
195 0.09
196 0.1
197 0.1
198 0.1
199 0.11
200 0.12
201 0.14
202 0.14
203 0.14
204 0.17
205 0.16
206 0.17
207 0.16
208 0.15
209 0.12
210 0.12
211 0.1
212 0.08
213 0.08
214 0.07
215 0.08
216 0.08
217 0.09
218 0.09
219 0.09
220 0.11
221 0.12
222 0.13
223 0.19
224 0.18
225 0.19
226 0.24
227 0.25
228 0.25
229 0.29
230 0.3
231 0.25
232 0.25
233 0.23
234 0.17
235 0.16
236 0.17
237 0.12
238 0.12
239 0.12
240 0.12
241 0.12
242 0.14
243 0.13
244 0.12
245 0.17
246 0.15
247 0.14
248 0.16
249 0.18
250 0.18
251 0.23
252 0.25
253 0.22
254 0.23
255 0.24
256 0.21
257 0.22
258 0.21
259 0.18
260 0.15
261 0.15
262 0.15
263 0.14
264 0.15
265 0.13
266 0.11
267 0.1
268 0.09
269 0.07
270 0.06
271 0.06
272 0.04
273 0.04
274 0.05
275 0.06
276 0.06
277 0.06
278 0.06
279 0.08
280 0.09
281 0.18
282 0.19
283 0.25
284 0.32
285 0.42
286 0.53
287 0.55
288 0.59
289 0.58
290 0.65
291 0.63
292 0.62
293 0.6
294 0.56
295 0.58
296 0.56
297 0.52
298 0.44
299 0.42
300 0.36
301 0.3
302 0.29
303 0.32
304 0.39
305 0.45
306 0.55
307 0.64
308 0.69
309 0.77
310 0.83
311 0.84