Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075ASA4

Protein Details
Accession A0A075ASA4   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
215-257EIKENSKRQKKQDEKPNKKQKVEETPKKEKKNEKKVNETPKPABasic
NLS Segment(s)
PositionSequence
220-291SKRQKKQDEKPNKKQKVEETPKKEKKNEKKVNETPKPAEKKVTETPKKAAEKKVAETPKKVAETPKKESNKK
Subcellular Location(s) nucl 15.5, cyto 10, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR041232  NPL  
IPR046357  PPIase_dom_sf  
IPR001179  PPIase_FKBP_dom  
IPR023566  PPIase_Fpr3/Fpr4-like  
Gene Ontology GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
Pfam View protein in Pfam  
PF00254  FKBP_C  
PF17800  NPL  
PROSITE View protein in PROSITE  
PS50059  FKBP_PPIASE  
Amino Acid Sequences MQFWGLQVEPTKLYSQTVDASYKVTMAAIDPSAKDGEKVVLKVRVNNDMEFVLCTLVAGREEPKVESPVKDSAHASETEVVKGDVEMEAKDEESSDEESDEEAEMTKEEVISLLKQQGHSEKEIEEMLNGEDDDSEEEDEDSEGEEMTKEQFVELLKAEGKTDEEIEEILAEEEDEDEEFEQIVESLKKEGYSDEQIQEMLEQMADDDEVDSDEEIKENSKRQKKQDEKPNKKQKVEETPKKEKKNEKKVNETPKPAEKKVTETPKKAAEKKVAETPKKVAETPKKESNKKTLANGLVIEDRKVGDGKKASKNNKVAVRYVGKLSNGKVFDSNTKGRPFEFVLGKGQVIKGWDLGIEGMAIGGERRLVIPAPLAYGKQGAGDIPKNATLTFDVKLLAIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.23
4 0.25
5 0.25
6 0.23
7 0.24
8 0.23
9 0.22
10 0.19
11 0.15
12 0.11
13 0.1
14 0.12
15 0.12
16 0.14
17 0.14
18 0.16
19 0.18
20 0.18
21 0.17
22 0.15
23 0.19
24 0.21
25 0.23
26 0.26
27 0.31
28 0.33
29 0.39
30 0.41
31 0.45
32 0.44
33 0.42
34 0.39
35 0.32
36 0.31
37 0.25
38 0.22
39 0.13
40 0.1
41 0.09
42 0.08
43 0.09
44 0.09
45 0.09
46 0.1
47 0.13
48 0.14
49 0.16
50 0.18
51 0.22
52 0.24
53 0.24
54 0.27
55 0.31
56 0.31
57 0.31
58 0.3
59 0.28
60 0.28
61 0.27
62 0.25
63 0.24
64 0.24
65 0.22
66 0.21
67 0.19
68 0.16
69 0.15
70 0.14
71 0.09
72 0.09
73 0.08
74 0.09
75 0.09
76 0.1
77 0.1
78 0.09
79 0.08
80 0.1
81 0.12
82 0.11
83 0.1
84 0.1
85 0.11
86 0.11
87 0.11
88 0.08
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.06
95 0.06
96 0.06
97 0.07
98 0.08
99 0.1
100 0.14
101 0.16
102 0.16
103 0.19
104 0.24
105 0.26
106 0.27
107 0.26
108 0.22
109 0.22
110 0.22
111 0.2
112 0.14
113 0.12
114 0.1
115 0.09
116 0.09
117 0.07
118 0.06
119 0.06
120 0.07
121 0.07
122 0.07
123 0.06
124 0.07
125 0.07
126 0.07
127 0.06
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.06
135 0.07
136 0.06
137 0.06
138 0.07
139 0.08
140 0.09
141 0.09
142 0.1
143 0.11
144 0.11
145 0.12
146 0.11
147 0.11
148 0.1
149 0.11
150 0.09
151 0.08
152 0.08
153 0.07
154 0.07
155 0.06
156 0.05
157 0.04
158 0.04
159 0.03
160 0.03
161 0.04
162 0.04
163 0.03
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.05
171 0.05
172 0.06
173 0.07
174 0.07
175 0.07
176 0.08
177 0.08
178 0.1
179 0.15
180 0.17
181 0.17
182 0.17
183 0.17
184 0.16
185 0.15
186 0.12
187 0.08
188 0.05
189 0.04
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.04
198 0.03
199 0.04
200 0.04
201 0.04
202 0.05
203 0.06
204 0.08
205 0.14
206 0.23
207 0.31
208 0.37
209 0.44
210 0.55
211 0.63
212 0.71
213 0.76
214 0.79
215 0.81
216 0.86
217 0.9
218 0.87
219 0.82
220 0.77
221 0.74
222 0.74
223 0.75
224 0.73
225 0.71
226 0.75
227 0.8
228 0.82
229 0.81
230 0.8
231 0.8
232 0.82
233 0.82
234 0.79
235 0.81
236 0.83
237 0.86
238 0.83
239 0.79
240 0.73
241 0.72
242 0.71
243 0.62
244 0.6
245 0.5
246 0.49
247 0.51
248 0.57
249 0.55
250 0.52
251 0.54
252 0.57
253 0.63
254 0.62
255 0.6
256 0.58
257 0.55
258 0.55
259 0.6
260 0.6
261 0.57
262 0.54
263 0.52
264 0.5
265 0.47
266 0.46
267 0.46
268 0.47
269 0.51
270 0.55
271 0.61
272 0.63
273 0.67
274 0.71
275 0.72
276 0.71
277 0.66
278 0.64
279 0.61
280 0.55
281 0.51
282 0.45
283 0.38
284 0.34
285 0.31
286 0.27
287 0.2
288 0.18
289 0.17
290 0.18
291 0.16
292 0.16
293 0.23
294 0.3
295 0.39
296 0.48
297 0.53
298 0.6
299 0.66
300 0.68
301 0.69
302 0.65
303 0.58
304 0.57
305 0.56
306 0.49
307 0.47
308 0.42
309 0.38
310 0.38
311 0.36
312 0.36
313 0.32
314 0.31
315 0.29
316 0.29
317 0.31
318 0.35
319 0.39
320 0.38
321 0.41
322 0.41
323 0.39
324 0.4
325 0.38
326 0.38
327 0.36
328 0.32
329 0.33
330 0.34
331 0.34
332 0.32
333 0.29
334 0.23
335 0.21
336 0.19
337 0.14
338 0.13
339 0.13
340 0.11
341 0.11
342 0.1
343 0.07
344 0.06
345 0.05
346 0.05
347 0.04
348 0.04
349 0.04
350 0.04
351 0.05
352 0.05
353 0.07
354 0.08
355 0.09
356 0.12
357 0.13
358 0.17
359 0.18
360 0.18
361 0.18
362 0.19
363 0.19
364 0.16
365 0.16
366 0.13
367 0.18
368 0.21
369 0.22
370 0.24
371 0.26
372 0.26
373 0.25
374 0.26
375 0.23
376 0.22
377 0.21
378 0.19
379 0.17