Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075B1P0

Protein Details
Accession A0A075B1P0    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-31IIPHSTKKPNPLTKARKDYQHydrophilic
50-81RNQQLKQEKERRRDQSRKKLLQRNKRGQPVLKHydrophilic
NLS Segment(s)
PositionSequence
17-76TKKPNPLTKARKDYQEKKKNEDEIKKNKEEEKIRNQQLKQEKERRRDQSRKKLLQRNKRG
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MESLKNDDSKKIIPHSTKKPNPLTKARKDYQEKKKNEDEIKKNKEEEKIRNQQLKQEKERRRDQSRKKLLQRNKRGQPVLKNHINHLLHKIKSEMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.67
4 0.69
5 0.73
6 0.77
7 0.77
8 0.77
9 0.79
10 0.79
11 0.78
12 0.8
13 0.75
14 0.75
15 0.76
16 0.78
17 0.79
18 0.79
19 0.73
20 0.7
21 0.74
22 0.73
23 0.72
24 0.71
25 0.7
26 0.7
27 0.74
28 0.7
29 0.66
30 0.61
31 0.6
32 0.57
33 0.55
34 0.54
35 0.56
36 0.59
37 0.63
38 0.59
39 0.59
40 0.62
41 0.62
42 0.61
43 0.62
44 0.63
45 0.65
46 0.74
47 0.76
48 0.77
49 0.8
50 0.81
51 0.82
52 0.85
53 0.87
54 0.88
55 0.89
56 0.89
57 0.89
58 0.89
59 0.89
60 0.87
61 0.86
62 0.83
63 0.8
64 0.8
65 0.79
66 0.77
67 0.74
68 0.67
69 0.61
70 0.64
71 0.59
72 0.52
73 0.51
74 0.49
75 0.43
76 0.43