Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075B2E9

Protein Details
Accession A0A075B2E9    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
18-38SKSYCPYCKKAKKLFENINVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 8.5, cyto_nucl 8.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011767  GLR_AS  
IPR002109  Glutaredoxin  
IPR011899  Glutaredoxin_euk/vir  
IPR014025  Glutaredoxin_subgr  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF00462  Glutaredoxin  
PROSITE View protein in PROSITE  
PS00195  GLUTAREDOXIN_1  
PS51354  GLUTAREDOXIN_2  
CDD cd03419  GRX_GRXh_1_2_like  
Amino Acid Sequences MNALVKKLIAENNVMIFSKSYCPYCKKAKKLFENINVSYFALELDQESNGSEIQNELAKMTGQTTVPNIFIKGNHLGGCDDTYEAFNSGKLQKLLKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.17
4 0.17
5 0.18
6 0.19
7 0.2
8 0.23
9 0.28
10 0.33
11 0.44
12 0.51
13 0.56
14 0.63
15 0.7
16 0.74
17 0.79
18 0.83
19 0.81
20 0.79
21 0.71
22 0.63
23 0.54
24 0.45
25 0.34
26 0.25
27 0.16
28 0.08
29 0.07
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.05
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.08
49 0.07
50 0.08
51 0.1
52 0.11
53 0.13
54 0.13
55 0.14
56 0.13
57 0.13
58 0.16
59 0.17
60 0.18
61 0.17
62 0.18
63 0.18
64 0.18
65 0.19
66 0.15
67 0.13
68 0.11
69 0.12
70 0.12
71 0.13
72 0.12
73 0.11
74 0.15
75 0.17
76 0.22
77 0.23