Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9ITY9

Protein Details
Accession W9ITY9   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
138-165APVKNHKPVSKAKRRKMIKQELQKSAQAHydrophilic
NLS Segment(s)
PositionSequence
143-154HKPVSKAKRRKM
Subcellular Location(s) cyto 8.5, cyto_nucl 7.5, mito 6, nucl 5.5, plas 3, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MARLLLSSGQVQVIASGFVVVICTFALFISGYIIQQRTLTQLRSAIKPRQETRPSPKVYLPEKFQVRTKELEDGRVIDIDTEADIEVRRQRLLVEIKETKPNVDAEGNAALERNIEIIKQLQAKVVDKMSTPEGHVEAPVKNHKPVSKAKRRKMIKQELQKSAQAEDGLYYQRRMW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.06
4 0.06
5 0.05
6 0.06
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.06
14 0.05
15 0.05
16 0.07
17 0.08
18 0.08
19 0.11
20 0.12
21 0.12
22 0.12
23 0.13
24 0.16
25 0.19
26 0.19
27 0.18
28 0.23
29 0.26
30 0.31
31 0.37
32 0.38
33 0.41
34 0.47
35 0.49
36 0.54
37 0.58
38 0.59
39 0.63
40 0.66
41 0.64
42 0.59
43 0.58
44 0.56
45 0.54
46 0.52
47 0.47
48 0.45
49 0.46
50 0.44
51 0.46
52 0.43
53 0.41
54 0.39
55 0.36
56 0.36
57 0.32
58 0.33
59 0.29
60 0.26
61 0.24
62 0.21
63 0.19
64 0.11
65 0.11
66 0.07
67 0.07
68 0.05
69 0.04
70 0.04
71 0.04
72 0.05
73 0.08
74 0.09
75 0.09
76 0.08
77 0.09
78 0.14
79 0.18
80 0.19
81 0.23
82 0.27
83 0.29
84 0.34
85 0.34
86 0.29
87 0.26
88 0.25
89 0.21
90 0.17
91 0.15
92 0.12
93 0.14
94 0.13
95 0.11
96 0.11
97 0.09
98 0.08
99 0.08
100 0.07
101 0.05
102 0.04
103 0.05
104 0.07
105 0.11
106 0.14
107 0.14
108 0.16
109 0.19
110 0.21
111 0.23
112 0.24
113 0.21
114 0.18
115 0.2
116 0.2
117 0.19
118 0.18
119 0.17
120 0.17
121 0.16
122 0.17
123 0.17
124 0.15
125 0.2
126 0.27
127 0.28
128 0.3
129 0.34
130 0.35
131 0.39
132 0.48
133 0.54
134 0.57
135 0.65
136 0.71
137 0.77
138 0.81
139 0.86
140 0.87
141 0.87
142 0.86
143 0.86
144 0.87
145 0.85
146 0.82
147 0.76
148 0.66
149 0.57
150 0.5
151 0.39
152 0.3
153 0.23
154 0.21
155 0.23
156 0.23