Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9I3B6

Protein Details
Accession W9I3B6   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPFKRFKNEKEKKRARQAFVRQGATRHydrophilic
NLS Segment(s)
PositionSequence
7-15KNEKEKKRA
Subcellular Location(s) nucl 9cyto 9cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MPFKRFKNEKEKKRARQAFVRQGATRLQGTMESLDKTPARPFAVMSDTHQGPDYPKFATVKEITTNVLCDHLAQAGFASVSEQSFNFEIDCFVWNQYFSHLGDEAPEGPWMPYYGSDLYQHVGRVSEVYQQWRHDQGLPFVSPHTPLDVPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.88
3 0.88
4 0.88
5 0.87
6 0.84
7 0.81
8 0.7
9 0.63
10 0.59
11 0.52
12 0.42
13 0.31
14 0.24
15 0.17
16 0.18
17 0.17
18 0.16
19 0.14
20 0.14
21 0.18
22 0.18
23 0.19
24 0.2
25 0.21
26 0.21
27 0.2
28 0.2
29 0.19
30 0.22
31 0.21
32 0.21
33 0.24
34 0.22
35 0.22
36 0.22
37 0.18
38 0.18
39 0.2
40 0.18
41 0.13
42 0.15
43 0.16
44 0.16
45 0.21
46 0.2
47 0.18
48 0.19
49 0.19
50 0.18
51 0.17
52 0.18
53 0.13
54 0.13
55 0.1
56 0.08
57 0.08
58 0.08
59 0.07
60 0.06
61 0.06
62 0.05
63 0.05
64 0.04
65 0.04
66 0.03
67 0.04
68 0.04
69 0.04
70 0.06
71 0.06
72 0.07
73 0.06
74 0.06
75 0.07
76 0.07
77 0.08
78 0.07
79 0.08
80 0.08
81 0.08
82 0.09
83 0.09
84 0.11
85 0.11
86 0.12
87 0.12
88 0.11
89 0.12
90 0.13
91 0.12
92 0.1
93 0.1
94 0.08
95 0.08
96 0.09
97 0.08
98 0.08
99 0.07
100 0.1
101 0.11
102 0.13
103 0.14
104 0.15
105 0.16
106 0.16
107 0.17
108 0.14
109 0.13
110 0.12
111 0.12
112 0.12
113 0.17
114 0.19
115 0.25
116 0.29
117 0.31
118 0.35
119 0.37
120 0.39
121 0.38
122 0.39
123 0.38
124 0.39
125 0.38
126 0.35
127 0.32
128 0.31
129 0.27
130 0.25
131 0.24