Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9HGW7

Protein Details
Accession W9HGW7   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
69-91PDCRRLAKPECRGMKKPRITREKBasic
NLS Segment(s)
PositionSequence
84-86KPR
Subcellular Location(s) nucl 13, mito_nucl 11.333, cyto_nucl 9.333, mito 8.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MQLPSCKKGSEPFGAPKAAEVGRGSAKLQVSVSESATTLNVERQDAANVVWAARAAEVGRTGSQGAQSPDCRRLAKPECRGMKKPRITREK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.44
3 0.38
4 0.36
5 0.29
6 0.25
7 0.18
8 0.17
9 0.18
10 0.19
11 0.19
12 0.18
13 0.18
14 0.17
15 0.17
16 0.15
17 0.16
18 0.16
19 0.16
20 0.13
21 0.13
22 0.12
23 0.12
24 0.11
25 0.08
26 0.09
27 0.09
28 0.08
29 0.09
30 0.09
31 0.09
32 0.09
33 0.09
34 0.1
35 0.09
36 0.09
37 0.08
38 0.08
39 0.08
40 0.07
41 0.07
42 0.04
43 0.05
44 0.06
45 0.07
46 0.07
47 0.08
48 0.09
49 0.09
50 0.1
51 0.13
52 0.14
53 0.18
54 0.22
55 0.25
56 0.29
57 0.33
58 0.34
59 0.32
60 0.39
61 0.45
62 0.5
63 0.55
64 0.6
65 0.66
66 0.72
67 0.79
68 0.79
69 0.8
70 0.8
71 0.81