W9IRR2
Protein Details
| Accession | W9IRR2  |
Localization Confidence | Low | Confidence Score | 9.5 | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| NoLS Segment(s) |
|
||||||||||
| NLS Segment(s) |
|
||||||||||
| Subcellular Location(s) | nucl 15, mito 9, cyto_nucl 9 | ||||||||||
| Family & Domain DBs |
|
||||||||||
| Amino Acid Sequences | MSVAGAGIGGRQQNYKRMPLKGKRNKTINGKV | ||||||||||
| FASTA Sequence with NoLS information |
|||||||||||
| AlphaFold Structure with highlighted NoLS |
|||||||||||
NoLS Predictions per Residue
| Residue Number | Score |
|---|---|
| 1 | 0.24 |
| 2 | 0.32 |
| 3 | 0.34 |
| 4 | 0.39 |
| 5 | 0.48 |
| 6 | 0.53 |
| 7 | 0.63 |
| 8 | 0.67 |
| 9 | 0.74 |
| 10 | 0.76 |
| 11 | 0.79 |
| 12 | 0.81 |