Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9HQG4

Protein Details
Accession W9HQG4   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-27ATFSDKIHNPDKRQKPHLKNNPEITAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 8
Family & Domain DBs
Amino Acid Sequences MATFSDKIHNPDKRQKPHLKNNPEITALPASSPIEDITNIIRRDGGIIIKNFITPEEADPHYQKVGKYEETLFPLLIYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.82
4 0.85
5 0.88
6 0.87
7 0.85
8 0.84
9 0.77
10 0.69
11 0.59
12 0.51
13 0.43
14 0.33
15 0.25
16 0.19
17 0.15
18 0.12
19 0.13
20 0.09
21 0.08
22 0.07
23 0.08
24 0.09
25 0.15
26 0.15
27 0.14
28 0.14
29 0.13
30 0.15
31 0.15
32 0.15
33 0.13
34 0.13
35 0.15
36 0.15
37 0.16
38 0.14
39 0.13
40 0.13
41 0.1
42 0.11
43 0.15
44 0.16
45 0.19
46 0.21
47 0.23
48 0.24
49 0.26
50 0.24
51 0.24
52 0.28
53 0.27
54 0.29
55 0.3
56 0.32
57 0.34
58 0.36
59 0.3