Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9J235

Protein Details
Accession W9J235    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
105-124RNTLAARKYRQKRLDRISELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR031106  C/EBP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd12193  bZIP_GCN4  
Amino Acid Sequences MGEGLFDQIMISDMNALDTNTQLDVGDGFLAQEQPLITVNSSPLEQPSTSSTPHPTTTNKSPSSSIPGTSTFSLHPSPSSSSGSSRKRKSSPEDEESAVTLKRQRNTLAARKYRQKRLDRISELEEALAAMTNERDDMRLQLARREAEVDALREMLGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.09
5 0.09
6 0.1
7 0.09
8 0.09
9 0.07
10 0.07
11 0.07
12 0.07
13 0.07
14 0.05
15 0.05
16 0.06
17 0.06
18 0.06
19 0.07
20 0.06
21 0.07
22 0.08
23 0.09
24 0.09
25 0.09
26 0.1
27 0.1
28 0.1
29 0.1
30 0.1
31 0.11
32 0.11
33 0.12
34 0.16
35 0.18
36 0.18
37 0.2
38 0.23
39 0.23
40 0.25
41 0.27
42 0.25
43 0.29
44 0.36
45 0.42
46 0.4
47 0.39
48 0.38
49 0.37
50 0.41
51 0.35
52 0.28
53 0.22
54 0.22
55 0.22
56 0.21
57 0.21
58 0.14
59 0.15
60 0.15
61 0.13
62 0.12
63 0.12
64 0.13
65 0.14
66 0.16
67 0.15
68 0.18
69 0.25
70 0.34
71 0.4
72 0.42
73 0.46
74 0.48
75 0.53
76 0.56
77 0.58
78 0.58
79 0.55
80 0.54
81 0.49
82 0.46
83 0.41
84 0.35
85 0.25
86 0.18
87 0.19
88 0.19
89 0.2
90 0.22
91 0.23
92 0.29
93 0.36
94 0.44
95 0.49
96 0.53
97 0.57
98 0.65
99 0.71
100 0.74
101 0.76
102 0.76
103 0.75
104 0.76
105 0.8
106 0.75
107 0.72
108 0.66
109 0.6
110 0.52
111 0.42
112 0.33
113 0.22
114 0.17
115 0.13
116 0.08
117 0.05
118 0.05
119 0.05
120 0.07
121 0.07
122 0.08
123 0.08
124 0.1
125 0.15
126 0.19
127 0.2
128 0.25
129 0.3
130 0.3
131 0.3
132 0.31
133 0.26
134 0.29
135 0.31
136 0.27
137 0.23
138 0.23
139 0.21