Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9HRJ2

Protein Details
Accession W9HRJ2    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MVNHRVTYRRRNGWNTRSNTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 8.5, cyto_nucl 8.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
Amino Acid Sequences MVNHRVTYRRRNGWNTRSNTTRTIRTPGGELRVLHIKKRGTVPKCGDCGSKLSGIPALRPREYSQISKPQKTVQRAYGGSRCGNCVRDRIVRAFLIEEQKIVKKVLKEQEQSQKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.76
4 0.72
5 0.68
6 0.65
7 0.6
8 0.56
9 0.5
10 0.5
11 0.45
12 0.41
13 0.42
14 0.38
15 0.38
16 0.34
17 0.31
18 0.28
19 0.35
20 0.34
21 0.32
22 0.34
23 0.31
24 0.3
25 0.39
26 0.44
27 0.38
28 0.46
29 0.51
30 0.52
31 0.53
32 0.51
33 0.44
34 0.36
35 0.36
36 0.29
37 0.25
38 0.18
39 0.16
40 0.18
41 0.16
42 0.18
43 0.21
44 0.23
45 0.21
46 0.23
47 0.24
48 0.27
49 0.3
50 0.31
51 0.3
52 0.37
53 0.42
54 0.43
55 0.43
56 0.43
57 0.47
58 0.49
59 0.49
60 0.43
61 0.45
62 0.44
63 0.47
64 0.45
65 0.41
66 0.39
67 0.35
68 0.34
69 0.3
70 0.31
71 0.28
72 0.27
73 0.29
74 0.33
75 0.35
76 0.35
77 0.36
78 0.34
79 0.33
80 0.32
81 0.31
82 0.3
83 0.27
84 0.24
85 0.24
86 0.27
87 0.28
88 0.27
89 0.27
90 0.24
91 0.33
92 0.41
93 0.48
94 0.49
95 0.56
96 0.65