Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9HW40

Protein Details
Accession W9HW40    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
273-358GWNQSGKKNRRPRLDEYRREESKRKEGRRHEDSYKRERERERERDRDSRHGHRDRDRYRDRDRDHDRDRNRDYDRHRSHRDYDRRRBasic
NLS Segment(s)
PositionSequence
244-266PRGTVKEVKRRPNRIGLGAKELK
277-336SGKKNRRPRLDEYRREESKRKEGRRHEDSYKRERERERERDRDSRHGHRDRDRYRDRDRD
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR045166  Spp2-like  
IPR026822  Spp2/MOS2_G-patch  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF12656  G-patch_2  
Amino Acid Sequences MSEQSKPPAPRIAIKFGATSNNNNSKKASKPNPPSSLGKRPRSHALGGASDSEDDDYEHRGRHEKITGFGVDGAETERKAKDSRMEKKDYVIARQSNHDWRSEAKAQRKSKNSLPEEARAQQNNTTVETEPADQDKGLKWGLTIKEKTEDDNKDIGSESKEKPVSNDDDQKKPPPKRTADDEAMEALLGNKEEDEKIIHPTEADAYRRDIQGAGETSTLDDYEAMPVEEFGAALLRGMGWDGKPRGTVKEVKRRPNRIGLGAKELKGEEDLGGWNQSGKKNRRPRLDEYRREESKRKEGRRHEDSYKRERERERERDRDSRHGHRDRDRYRDRDRDHDRDRNRDYDRHRSHRDYDRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.43
4 0.48
5 0.43
6 0.42
7 0.44
8 0.5
9 0.51
10 0.5
11 0.51
12 0.48
13 0.52
14 0.56
15 0.56
16 0.56
17 0.64
18 0.73
19 0.76
20 0.76
21 0.78
22 0.75
23 0.77
24 0.76
25 0.76
26 0.7
27 0.68
28 0.72
29 0.68
30 0.62
31 0.57
32 0.52
33 0.46
34 0.43
35 0.4
36 0.32
37 0.27
38 0.25
39 0.19
40 0.14
41 0.11
42 0.11
43 0.13
44 0.14
45 0.16
46 0.17
47 0.22
48 0.25
49 0.29
50 0.35
51 0.33
52 0.34
53 0.37
54 0.36
55 0.31
56 0.3
57 0.25
58 0.18
59 0.16
60 0.16
61 0.13
62 0.12
63 0.13
64 0.12
65 0.14
66 0.16
67 0.19
68 0.24
69 0.33
70 0.43
71 0.5
72 0.56
73 0.55
74 0.57
75 0.61
76 0.55
77 0.51
78 0.48
79 0.44
80 0.39
81 0.42
82 0.44
83 0.46
84 0.45
85 0.41
86 0.34
87 0.32
88 0.38
89 0.42
90 0.44
91 0.44
92 0.52
93 0.59
94 0.65
95 0.7
96 0.67
97 0.66
98 0.69
99 0.63
100 0.62
101 0.58
102 0.55
103 0.53
104 0.52
105 0.51
106 0.43
107 0.41
108 0.36
109 0.36
110 0.32
111 0.29
112 0.27
113 0.22
114 0.21
115 0.2
116 0.18
117 0.15
118 0.15
119 0.13
120 0.11
121 0.12
122 0.12
123 0.13
124 0.12
125 0.11
126 0.1
127 0.15
128 0.18
129 0.25
130 0.25
131 0.24
132 0.29
133 0.3
134 0.32
135 0.34
136 0.33
137 0.3
138 0.31
139 0.3
140 0.24
141 0.25
142 0.23
143 0.18
144 0.21
145 0.18
146 0.22
147 0.24
148 0.23
149 0.24
150 0.28
151 0.3
152 0.3
153 0.38
154 0.36
155 0.4
156 0.42
157 0.49
158 0.53
159 0.52
160 0.56
161 0.54
162 0.56
163 0.54
164 0.59
165 0.58
166 0.53
167 0.5
168 0.42
169 0.34
170 0.29
171 0.24
172 0.17
173 0.1
174 0.06
175 0.05
176 0.04
177 0.04
178 0.04
179 0.05
180 0.05
181 0.07
182 0.07
183 0.11
184 0.12
185 0.12
186 0.11
187 0.12
188 0.15
189 0.16
190 0.16
191 0.14
192 0.17
193 0.19
194 0.19
195 0.19
196 0.16
197 0.14
198 0.17
199 0.17
200 0.14
201 0.12
202 0.12
203 0.12
204 0.11
205 0.11
206 0.07
207 0.06
208 0.05
209 0.06
210 0.06
211 0.06
212 0.05
213 0.05
214 0.06
215 0.05
216 0.05
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.03
223 0.03
224 0.04
225 0.05
226 0.05
227 0.11
228 0.12
229 0.13
230 0.16
231 0.18
232 0.2
233 0.24
234 0.32
235 0.36
236 0.46
237 0.53
238 0.6
239 0.69
240 0.73
241 0.74
242 0.75
243 0.7
244 0.68
245 0.67
246 0.6
247 0.59
248 0.56
249 0.51
250 0.43
251 0.39
252 0.31
253 0.24
254 0.22
255 0.13
256 0.1
257 0.11
258 0.1
259 0.11
260 0.1
261 0.12
262 0.15
263 0.2
264 0.28
265 0.34
266 0.43
267 0.53
268 0.61
269 0.69
270 0.72
271 0.77
272 0.79
273 0.83
274 0.83
275 0.8
276 0.82
277 0.79
278 0.78
279 0.77
280 0.74
281 0.73
282 0.74
283 0.75
284 0.75
285 0.79
286 0.83
287 0.83
288 0.83
289 0.82
290 0.81
291 0.8
292 0.81
293 0.81
294 0.77
295 0.77
296 0.77
297 0.77
298 0.79
299 0.81
300 0.81
301 0.8
302 0.81
303 0.83
304 0.81
305 0.82
306 0.79
307 0.78
308 0.79
309 0.78
310 0.79
311 0.78
312 0.83
313 0.8
314 0.83
315 0.82
316 0.79
317 0.8
318 0.82
319 0.78
320 0.78
321 0.8
322 0.8
323 0.8
324 0.82
325 0.8
326 0.8
327 0.81
328 0.79
329 0.76
330 0.74
331 0.72
332 0.73
333 0.76
334 0.75
335 0.78
336 0.76
337 0.78
338 0.81