Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1HCP9

Protein Details
Accession C1HCP9    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-30APAASSGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-24GGKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.333, mito_nucl 11.166, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG pbl:PAAG_08540  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAASSGGKKQKKKWSKGKVKDKANHAVVLDKATSEKLYKDVQSYRLITVATLVDRLKINGSLARKALSDLEEKGQIKKVVGHSKMNIYSSNKFVCCNVARAVTAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.83
4 0.86
5 0.91
6 0.93
7 0.92
8 0.92
9 0.88
10 0.85
11 0.83
12 0.75
13 0.66
14 0.56
15 0.49
16 0.4
17 0.35
18 0.27
19 0.18
20 0.15
21 0.13
22 0.14
23 0.11
24 0.11
25 0.12
26 0.14
27 0.15
28 0.19
29 0.21
30 0.24
31 0.28
32 0.29
33 0.26
34 0.24
35 0.23
36 0.18
37 0.16
38 0.13
39 0.09
40 0.09
41 0.08
42 0.08
43 0.09
44 0.09
45 0.09
46 0.09
47 0.09
48 0.11
49 0.13
50 0.14
51 0.15
52 0.15
53 0.15
54 0.15
55 0.16
56 0.14
57 0.15
58 0.14
59 0.16
60 0.21
61 0.21
62 0.22
63 0.26
64 0.25
65 0.23
66 0.27
67 0.33
68 0.36
69 0.39
70 0.42
71 0.4
72 0.46
73 0.49
74 0.46
75 0.43
76 0.39
77 0.39
78 0.39
79 0.41
80 0.35
81 0.33
82 0.32
83 0.34
84 0.32
85 0.32
86 0.3
87 0.28
88 0.28