Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9IM68

Protein Details
Accession W9IM68    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-33RDTYSEPPRSHRQSRRQPPPRRGPLVKQSEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MGRRDTYSEPPRSHRQSRRQPPPRRGPLVKQSESGFDWTPGIVLALLGAFTWLSHDFDNYKKKHEHCDDRRGSRSRDSERGRRRYRSSSRYPDDDYDDYDYRGERGYSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.74
3 0.77
4 0.84
5 0.88
6 0.89
7 0.91
8 0.91
9 0.92
10 0.91
11 0.89
12 0.84
13 0.8
14 0.8
15 0.8
16 0.71
17 0.63
18 0.54
19 0.48
20 0.43
21 0.39
22 0.29
23 0.2
24 0.18
25 0.15
26 0.14
27 0.1
28 0.09
29 0.05
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.02
37 0.02
38 0.04
39 0.05
40 0.06
41 0.06
42 0.07
43 0.09
44 0.14
45 0.22
46 0.22
47 0.26
48 0.3
49 0.32
50 0.41
51 0.48
52 0.54
53 0.54
54 0.64
55 0.67
56 0.69
57 0.76
58 0.71
59 0.66
60 0.63
61 0.63
62 0.59
63 0.61
64 0.61
65 0.63
66 0.68
67 0.76
68 0.75
69 0.75
70 0.75
71 0.76
72 0.79
73 0.78
74 0.79
75 0.79
76 0.78
77 0.76
78 0.74
79 0.67
80 0.64
81 0.57
82 0.5
83 0.46
84 0.41
85 0.36
86 0.32
87 0.28
88 0.22
89 0.23