Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9HUA8

Protein Details
Accession W9HUA8   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-31YDEPKRNRAEARRLKKREVDRKAQRSARERBasic
NLS Segment(s)
PositionSequence
6-34KRNRAEARRLKKREVDRKAQRSARERTKS
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MYDEPKRNRAEARRLKKREVDRKAQRSARERTKSRIAQLESMVENLRQNDTPAQITSLMDQLGNVTKERDKLLGVLDSLGSTIRCHLIDLTTSEPAPDTRSESSTQASTRGFAPPVLGEGILPIATTTTRVSSETTGSPMPQIPIDPPPNDPFTCDGWTYDGWTYNDWTYTVSNKPYPTTMAFDNSIHPPSVDISCRDSSRST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.83
4 0.84
5 0.84
6 0.82
7 0.82
8 0.82
9 0.84
10 0.86
11 0.83
12 0.81
13 0.79
14 0.79
15 0.79
16 0.78
17 0.74
18 0.71
19 0.75
20 0.72
21 0.7
22 0.69
23 0.61
24 0.56
25 0.53
26 0.5
27 0.4
28 0.37
29 0.31
30 0.24
31 0.22
32 0.19
33 0.19
34 0.15
35 0.17
36 0.17
37 0.18
38 0.19
39 0.18
40 0.18
41 0.16
42 0.16
43 0.15
44 0.14
45 0.12
46 0.1
47 0.09
48 0.09
49 0.12
50 0.12
51 0.12
52 0.12
53 0.14
54 0.16
55 0.17
56 0.17
57 0.13
58 0.14
59 0.15
60 0.15
61 0.13
62 0.12
63 0.11
64 0.09
65 0.09
66 0.08
67 0.07
68 0.05
69 0.06
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.08
76 0.1
77 0.12
78 0.11
79 0.11
80 0.1
81 0.1
82 0.1
83 0.11
84 0.09
85 0.11
86 0.11
87 0.13
88 0.15
89 0.16
90 0.17
91 0.17
92 0.16
93 0.16
94 0.14
95 0.13
96 0.13
97 0.13
98 0.13
99 0.11
100 0.11
101 0.08
102 0.09
103 0.09
104 0.08
105 0.06
106 0.06
107 0.06
108 0.05
109 0.05
110 0.03
111 0.03
112 0.03
113 0.05
114 0.05
115 0.06
116 0.07
117 0.08
118 0.1
119 0.11
120 0.13
121 0.13
122 0.15
123 0.14
124 0.14
125 0.14
126 0.14
127 0.14
128 0.12
129 0.12
130 0.11
131 0.17
132 0.21
133 0.21
134 0.23
135 0.26
136 0.3
137 0.29
138 0.29
139 0.25
140 0.25
141 0.27
142 0.24
143 0.21
144 0.2
145 0.2
146 0.22
147 0.2
148 0.22
149 0.2
150 0.21
151 0.23
152 0.21
153 0.21
154 0.18
155 0.18
156 0.15
157 0.18
158 0.21
159 0.24
160 0.27
161 0.28
162 0.3
163 0.29
164 0.31
165 0.3
166 0.3
167 0.28
168 0.28
169 0.29
170 0.28
171 0.29
172 0.3
173 0.29
174 0.25
175 0.22
176 0.19
177 0.19
178 0.23
179 0.23
180 0.21
181 0.25
182 0.3
183 0.31