Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9HUA8

Protein Details
Accession W9HUA8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-31YDEPKRNRAEARRLKKREVDRKAQRSARERBasic
NLS Segment(s)
PositionSequence
6-34KRNRAEARRLKKREVDRKAQRSARERTKS
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MYDEPKRNRAEARRLKKREVDRKAQRSARERTKSRIAQLESMVENLRQNDTPAQITSLMDQLGNVTKERDKLLGVLDSLGSTIRCHLIDLTTSEPAPDTRSESSTQASTRGFAPPVLGEGILPIATTTTRVSSETTGSPMPQIPIDPPPNDPFTCDGWTYDGWTYNDWTYTVSNKPYPTTMAFDNSIHPPSVDISCRDSSRST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.83
4 0.84
5 0.84
6 0.82
7 0.82
8 0.82
9 0.84
10 0.86
11 0.83
12 0.81
13 0.79
14 0.79
15 0.79
16 0.78
17 0.74
18 0.71
19 0.75
20 0.72
21 0.7
22 0.69
23 0.61
24 0.56
25 0.53
26 0.5
27 0.4
28 0.37
29 0.31
30 0.24
31 0.22
32 0.19
33 0.19
34 0.15
35 0.17
36 0.17
37 0.18
38 0.19
39 0.18
40 0.18
41 0.16
42 0.16
43 0.15
44 0.14
45 0.12
46 0.1
47 0.09
48 0.09
49 0.12
50 0.12
51 0.12
52 0.12
53 0.14
54 0.16
55 0.17
56 0.17
57 0.13
58 0.14
59 0.15
60 0.15
61 0.13
62 0.12
63 0.11
64 0.09
65 0.09
66 0.08
67 0.07
68 0.05
69 0.06
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.08
76 0.1
77 0.12
78 0.11
79 0.11
80 0.1
81 0.1
82 0.1
83 0.11
84 0.09
85 0.11
86 0.11
87 0.13
88 0.15
89 0.16
90 0.17
91 0.17
92 0.16
93 0.16
94 0.14
95 0.13
96 0.13
97 0.13
98 0.13
99 0.11
100 0.11
101 0.08
102 0.09
103 0.09
104 0.08
105 0.06
106 0.06
107 0.06
108 0.05
109 0.05
110 0.03
111 0.03
112 0.03
113 0.05
114 0.05
115 0.06
116 0.07
117 0.08
118 0.1
119 0.11
120 0.13
121 0.13
122 0.15
123 0.14
124 0.14
125 0.14
126 0.14
127 0.14
128 0.12
129 0.12
130 0.11
131 0.17
132 0.21
133 0.21
134 0.23
135 0.26
136 0.3
137 0.29
138 0.29
139 0.25
140 0.25
141 0.27
142 0.24
143 0.21
144 0.2
145 0.2
146 0.22
147 0.2
148 0.22
149 0.2
150 0.21
151 0.23
152 0.21
153 0.21
154 0.18
155 0.18
156 0.15
157 0.18
158 0.21
159 0.24
160 0.27
161 0.28
162 0.3
163 0.29
164 0.31
165 0.3
166 0.3
167 0.28
168 0.28
169 0.29
170 0.28
171 0.29
172 0.3
173 0.29
174 0.25
175 0.22
176 0.19
177 0.19
178 0.23
179 0.23
180 0.21
181 0.25
182 0.3
183 0.31