Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9J6G0

Protein Details
Accession W9J6G0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
94-128LVQKRRHGFLCRKRSKTGRKILLRRKIKGRRHIAQBasic
NLS Segment(s)
PositionSequence
103-126LCRKRSKTGRKILLRRKIKGRRHI
Subcellular Location(s) mito 21.5, mito_nucl 13.333, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MNTMFSSITRLARPVLAKPLTQSPRTFTTLVPLRPSLTPMNGAIRRTALPSSFTPSTAASADIVPSSAISAHPALGDMQIRCGPRNTMNGHTRLVQKRRHGFLCRKRSKTGRKILLRRKIKGRRHIAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.3
4 0.3
5 0.32
6 0.4
7 0.41
8 0.43
9 0.41
10 0.36
11 0.39
12 0.42
13 0.4
14 0.3
15 0.34
16 0.37
17 0.38
18 0.37
19 0.33
20 0.31
21 0.3
22 0.33
23 0.26
24 0.21
25 0.2
26 0.18
27 0.25
28 0.26
29 0.26
30 0.23
31 0.23
32 0.22
33 0.22
34 0.22
35 0.14
36 0.15
37 0.15
38 0.21
39 0.19
40 0.19
41 0.19
42 0.18
43 0.18
44 0.15
45 0.15
46 0.09
47 0.09
48 0.09
49 0.07
50 0.07
51 0.05
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.07
63 0.1
64 0.08
65 0.1
66 0.13
67 0.14
68 0.15
69 0.16
70 0.17
71 0.18
72 0.25
73 0.27
74 0.31
75 0.36
76 0.38
77 0.38
78 0.39
79 0.44
80 0.46
81 0.5
82 0.48
83 0.53
84 0.58
85 0.63
86 0.67
87 0.67
88 0.69
89 0.73
90 0.77
91 0.78
92 0.75
93 0.77
94 0.8
95 0.83
96 0.82
97 0.83
98 0.82
99 0.82
100 0.88
101 0.9
102 0.9
103 0.89
104 0.86
105 0.86
106 0.86
107 0.85
108 0.85