Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9J2M0

Protein Details
Accession W9J2M0   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPISKKDRRNKEHKKADAAGTBasic
NLS Segment(s)
PositionSequence
5-22KKDRRNKEHKKADAAGTR
Subcellular Location(s) nucl 16, mito_nucl 12.666, cyto_nucl 11.166, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR026939  ZNF706/At2g23090_sf  
Amino Acid Sequences MPISKKDRRNKEHKKADAAGTRAPVKANGLPVKAPKPTSICQNCRKEIVNTNKLQLEVHASTHDAKLWPKEKCWPNDFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.8
3 0.79
4 0.75
5 0.67
6 0.59
7 0.52
8 0.47
9 0.39
10 0.35
11 0.27
12 0.23
13 0.21
14 0.25
15 0.24
16 0.23
17 0.24
18 0.26
19 0.29
20 0.28
21 0.27
22 0.23
23 0.25
24 0.25
25 0.33
26 0.38
27 0.42
28 0.49
29 0.54
30 0.53
31 0.51
32 0.52
33 0.46
34 0.47
35 0.5
36 0.49
37 0.44
38 0.46
39 0.44
40 0.42
41 0.38
42 0.3
43 0.27
44 0.19
45 0.19
46 0.17
47 0.17
48 0.18
49 0.19
50 0.2
51 0.16
52 0.18
53 0.25
54 0.32
55 0.33
56 0.34
57 0.44
58 0.5
59 0.57