Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9HHP8

Protein Details
Accession W9HHP8   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MSLNKRFKKKKKEKKRKKRLPIDLAPVGLBasic
NLS Segment(s)
PositionSequence
5-20KRFKKKKKEKKRKKRL
Subcellular Location(s) mito 21, mito_nucl 12.833, cyto_mito 11.333, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MSLNKRFKKKKKEKKRKKRLPIDLAPVGLRLRETCLWGDRVTRLCPDCVWSLMLFTARSAGEVSSACESWNLDMMIIIESGLCYDGAHVFCLHPEHYAAAITGCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.98
3 0.97
4 0.97
5 0.97
6 0.96
7 0.95
8 0.92
9 0.89
10 0.81
11 0.72
12 0.61
13 0.51
14 0.4
15 0.3
16 0.22
17 0.13
18 0.14
19 0.13
20 0.15
21 0.15
22 0.17
23 0.19
24 0.19
25 0.21
26 0.2
27 0.22
28 0.21
29 0.23
30 0.22
31 0.21
32 0.2
33 0.21
34 0.19
35 0.16
36 0.16
37 0.12
38 0.11
39 0.11
40 0.12
41 0.09
42 0.07
43 0.08
44 0.07
45 0.08
46 0.08
47 0.07
48 0.07
49 0.08
50 0.09
51 0.09
52 0.09
53 0.09
54 0.09
55 0.09
56 0.08
57 0.11
58 0.1
59 0.08
60 0.08
61 0.09
62 0.09
63 0.09
64 0.08
65 0.05
66 0.05
67 0.05
68 0.05
69 0.04
70 0.04
71 0.05
72 0.08
73 0.09
74 0.11
75 0.11
76 0.11
77 0.12
78 0.15
79 0.15
80 0.13
81 0.13
82 0.14
83 0.14
84 0.15
85 0.13