Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9I2X6

Protein Details
Accession W9I2X6    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
198-225DGEVKPPKAKKIKAKKELEKNKNKWQEFBasic
NLS Segment(s)
PositionSequence
202-233KPPKAKKIKAKKELEKNKNKWQEFSAKSKFGK
Subcellular Location(s) nucl 15.5, cyto_nucl 13, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041297  Crb2_Tudor  
IPR002999  Tudor  
IPR043560  ZGPAT  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0045892  P:negative regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF18115  Tudor_3  
CDD cd20446  Tudor_SpSPF30-like  
Amino Acid Sequences MSSITEIEQEKKTYQEQFDIVLGQLRDDPDNAELKALKDELNSFIDLLDEQIAELKPAQAPKPAPKEPSPPPQPEKWSRENHPAFKKAAPVEEEKQAPVNYQVNDTILAKWVSGDKAFYPARITSITGSSTDPIYTVKFKTYDNTETLRSRDIRPVSNKRKADGTPTTSAPATPPAPGLVSSAGATVYPEAKKAAEQDGEVKPPKAKKIKAKKELEKNKNKWQEFSAKSKFGKNQKKDSMFRTPDGVHGRVGFTGSGQAMRKDPTRSRHVYQMNDELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.35
4 0.34
5 0.34
6 0.32
7 0.27
8 0.25
9 0.22
10 0.17
11 0.18
12 0.18
13 0.17
14 0.16
15 0.18
16 0.16
17 0.19
18 0.19
19 0.19
20 0.19
21 0.19
22 0.22
23 0.21
24 0.19
25 0.17
26 0.19
27 0.2
28 0.21
29 0.2
30 0.17
31 0.16
32 0.15
33 0.13
34 0.12
35 0.1
36 0.07
37 0.06
38 0.1
39 0.1
40 0.1
41 0.11
42 0.11
43 0.12
44 0.15
45 0.17
46 0.19
47 0.23
48 0.31
49 0.4
50 0.43
51 0.46
52 0.47
53 0.53
54 0.55
55 0.61
56 0.6
57 0.59
58 0.6
59 0.61
60 0.65
61 0.67
62 0.67
63 0.65
64 0.65
65 0.62
66 0.68
67 0.69
68 0.69
69 0.68
70 0.65
71 0.59
72 0.53
73 0.54
74 0.45
75 0.41
76 0.36
77 0.34
78 0.32
79 0.34
80 0.33
81 0.28
82 0.29
83 0.26
84 0.23
85 0.22
86 0.23
87 0.19
88 0.2
89 0.19
90 0.17
91 0.18
92 0.18
93 0.14
94 0.12
95 0.12
96 0.1
97 0.1
98 0.11
99 0.1
100 0.1
101 0.1
102 0.08
103 0.14
104 0.15
105 0.15
106 0.16
107 0.15
108 0.16
109 0.16
110 0.17
111 0.11
112 0.13
113 0.13
114 0.12
115 0.12
116 0.11
117 0.1
118 0.09
119 0.08
120 0.08
121 0.09
122 0.09
123 0.1
124 0.11
125 0.12
126 0.12
127 0.15
128 0.18
129 0.2
130 0.21
131 0.23
132 0.24
133 0.25
134 0.26
135 0.27
136 0.24
137 0.23
138 0.27
139 0.27
140 0.3
141 0.37
142 0.46
143 0.52
144 0.59
145 0.58
146 0.53
147 0.56
148 0.5
149 0.49
150 0.45
151 0.41
152 0.36
153 0.36
154 0.36
155 0.31
156 0.3
157 0.23
158 0.2
159 0.15
160 0.12
161 0.12
162 0.11
163 0.11
164 0.11
165 0.12
166 0.09
167 0.08
168 0.08
169 0.08
170 0.07
171 0.07
172 0.07
173 0.06
174 0.09
175 0.08
176 0.09
177 0.1
178 0.1
179 0.11
180 0.13
181 0.17
182 0.15
183 0.16
184 0.21
185 0.24
186 0.29
187 0.3
188 0.29
189 0.29
190 0.31
191 0.39
192 0.42
193 0.46
194 0.51
195 0.61
196 0.7
197 0.76
198 0.83
199 0.84
200 0.87
201 0.91
202 0.91
203 0.91
204 0.87
205 0.88
206 0.87
207 0.8
208 0.72
209 0.66
210 0.66
211 0.6
212 0.62
213 0.59
214 0.56
215 0.57
216 0.6
217 0.62
218 0.63
219 0.68
220 0.67
221 0.7
222 0.73
223 0.79
224 0.78
225 0.77
226 0.77
227 0.72
228 0.65
229 0.6
230 0.51
231 0.5
232 0.5
233 0.45
234 0.36
235 0.32
236 0.31
237 0.26
238 0.26
239 0.19
240 0.13
241 0.15
242 0.13
243 0.17
244 0.17
245 0.19
246 0.21
247 0.25
248 0.29
249 0.33
250 0.4
251 0.43
252 0.51
253 0.55
254 0.57
255 0.64
256 0.67
257 0.66
258 0.66