Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9HZU1

Protein Details
Accession W9HZU1   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
25-51LKLHYFRVWNFPRKKNRGEKKIDTTLVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.833, cyto 13, nucl 12.5, mito_nucl 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR021139  NYN  
Gene Ontology GO:0004540  F:RNA nuclease activity  
Pfam View protein in Pfam  
PF01936  NYN  
Amino Acid Sequences MKVDEKVTSNVYGSNLEQGLVYQDLKLHYFRVWNFPRKKNRGEKKIDTTLVMGMALDAVHRQAFKETSAFVLVSGDNNMIPAVIYAVQCGYTVHVWVWKDSLSGEYTRLAGKHLIKLTLLDEFLVALTMTNYSVPVGKLPFPPNAVVLLNPWHELPKVLSQLTSANMTFMQSLSDGGCPDIDIVVVPEKRVRNQDARLRSMLEDFEKKGLNVISFAEYFHSLHQLQLFVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.18
4 0.17
5 0.15
6 0.16
7 0.15
8 0.15
9 0.1
10 0.13
11 0.14
12 0.16
13 0.17
14 0.16
15 0.16
16 0.21
17 0.23
18 0.31
19 0.38
20 0.46
21 0.54
22 0.62
23 0.72
24 0.73
25 0.81
26 0.82
27 0.84
28 0.85
29 0.85
30 0.85
31 0.83
32 0.84
33 0.76
34 0.66
35 0.57
36 0.47
37 0.38
38 0.28
39 0.19
40 0.1
41 0.08
42 0.06
43 0.05
44 0.04
45 0.04
46 0.05
47 0.06
48 0.06
49 0.09
50 0.1
51 0.11
52 0.12
53 0.12
54 0.13
55 0.14
56 0.13
57 0.11
58 0.11
59 0.1
60 0.09
61 0.1
62 0.08
63 0.07
64 0.07
65 0.07
66 0.05
67 0.05
68 0.04
69 0.04
70 0.06
71 0.06
72 0.06
73 0.06
74 0.07
75 0.07
76 0.07
77 0.08
78 0.06
79 0.06
80 0.07
81 0.1
82 0.1
83 0.1
84 0.11
85 0.09
86 0.09
87 0.09
88 0.1
89 0.09
90 0.09
91 0.1
92 0.09
93 0.1
94 0.11
95 0.1
96 0.1
97 0.12
98 0.13
99 0.17
100 0.17
101 0.17
102 0.16
103 0.17
104 0.16
105 0.14
106 0.12
107 0.08
108 0.06
109 0.06
110 0.06
111 0.05
112 0.04
113 0.03
114 0.03
115 0.03
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.05
122 0.07
123 0.08
124 0.1
125 0.15
126 0.17
127 0.19
128 0.2
129 0.2
130 0.19
131 0.2
132 0.18
133 0.14
134 0.12
135 0.13
136 0.13
137 0.13
138 0.12
139 0.11
140 0.11
141 0.12
142 0.13
143 0.16
144 0.18
145 0.18
146 0.18
147 0.17
148 0.19
149 0.2
150 0.2
151 0.14
152 0.12
153 0.11
154 0.12
155 0.11
156 0.1
157 0.09
158 0.06
159 0.07
160 0.08
161 0.09
162 0.08
163 0.08
164 0.08
165 0.08
166 0.08
167 0.07
168 0.06
169 0.05
170 0.06
171 0.12
172 0.13
173 0.13
174 0.18
175 0.21
176 0.25
177 0.31
178 0.36
179 0.37
180 0.46
181 0.54
182 0.57
183 0.6
184 0.58
185 0.55
186 0.5
187 0.44
188 0.39
189 0.36
190 0.33
191 0.29
192 0.31
193 0.3
194 0.28
195 0.3
196 0.29
197 0.24
198 0.2
199 0.2
200 0.2
201 0.19
202 0.19
203 0.18
204 0.18
205 0.17
206 0.18
207 0.21
208 0.17
209 0.2
210 0.22