Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9J4F2

Protein Details
Accession W9J4F2    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
3-23HQEAIKVRRQKKIRAHWQLAIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MKHQEAIKVRRQKKIRAHWQLAISISQLSFHDFPFPKLTFGGRIPPLRLGNPCRKSIILISCKLAFTLKLSSTSGSLRKPSRFPVCNTASCSNICRESQPFQECAVLEGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.8
4 0.8
5 0.77
6 0.74
7 0.68
8 0.58
9 0.48
10 0.38
11 0.28
12 0.21
13 0.16
14 0.13
15 0.14
16 0.13
17 0.13
18 0.2
19 0.19
20 0.22
21 0.27
22 0.27
23 0.24
24 0.24
25 0.25
26 0.2
27 0.2
28 0.24
29 0.23
30 0.24
31 0.24
32 0.28
33 0.28
34 0.27
35 0.3
36 0.3
37 0.36
38 0.37
39 0.37
40 0.35
41 0.33
42 0.32
43 0.32
44 0.34
45 0.28
46 0.27
47 0.27
48 0.27
49 0.27
50 0.26
51 0.22
52 0.14
53 0.12
54 0.14
55 0.13
56 0.14
57 0.15
58 0.15
59 0.16
60 0.19
61 0.21
62 0.19
63 0.25
64 0.28
65 0.31
66 0.33
67 0.4
68 0.46
69 0.47
70 0.49
71 0.53
72 0.54
73 0.54
74 0.58
75 0.53
76 0.46
77 0.43
78 0.41
79 0.36
80 0.34
81 0.3
82 0.27
83 0.29
84 0.32
85 0.39
86 0.41
87 0.38
88 0.36
89 0.39
90 0.35