Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9ILR5

Protein Details
Accession W9ILR5    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-42MEPQSKVRKKDKRPGGRDPGSRRKSKCWRWARKIKRSQSQGVBasic
NLS Segment(s)
PositionSequence
6-37KVRKKDKRPGGRDPGSRRKSKCWRWARKIKRS
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
Amino Acid Sequences MEPQSKVRKKDKRPGGRDPGSRRKSKCWRWARKIKRSQSQGVAGGAKACKRGRTQYQGSRHDATAMQLPLRAKQESR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.86
4 0.85
5 0.84
6 0.84
7 0.8
8 0.8
9 0.73
10 0.73
11 0.75
12 0.75
13 0.76
14 0.76
15 0.8
16 0.82
17 0.9
18 0.9
19 0.9
20 0.9
21 0.89
22 0.87
23 0.81
24 0.76
25 0.69
26 0.62
27 0.53
28 0.45
29 0.37
30 0.27
31 0.24
32 0.2
33 0.16
34 0.18
35 0.17
36 0.19
37 0.22
38 0.29
39 0.36
40 0.43
41 0.52
42 0.55
43 0.64
44 0.68
45 0.7
46 0.66
47 0.58
48 0.52
49 0.43
50 0.36
51 0.33
52 0.28
53 0.23
54 0.22
55 0.23
56 0.26
57 0.29