Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9HT53

Protein Details
Accession W9HT53    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-29AAKVIREKQKPKAKAKGTKAEKQKSEHydrophilic
71-90DSDTPKARMSNRKKQQGKDTHydrophilic
NLS Segment(s)
PositionSequence
8-57IREKQKPKAKAKGTKAEKQKSEARTKAVNAKKQILTKEKKKYNLKGKSQL
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MVEAAKVIREKQKPKAKAKGTKAEKQKSEARTKAVNAKKQILTKEKKKYNLKGKSQLSKREWESGKFTGSDSDTPKARMSNRKKQQGKDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.78
3 0.79
4 0.81
5 0.84
6 0.84
7 0.82
8 0.81
9 0.82
10 0.8
11 0.73
12 0.69
13 0.67
14 0.64
15 0.66
16 0.61
17 0.55
18 0.5
19 0.49
20 0.54
21 0.53
22 0.51
23 0.46
24 0.48
25 0.47
26 0.47
27 0.5
28 0.5
29 0.5
30 0.53
31 0.59
32 0.59
33 0.64
34 0.68
35 0.71
36 0.73
37 0.75
38 0.74
39 0.74
40 0.76
41 0.76
42 0.74
43 0.75
44 0.68
45 0.66
46 0.61
47 0.6
48 0.55
49 0.49
50 0.49
51 0.42
52 0.4
53 0.33
54 0.31
55 0.26
56 0.26
57 0.27
58 0.25
59 0.27
60 0.27
61 0.28
62 0.3
63 0.31
64 0.36
65 0.42
66 0.47
67 0.54
68 0.63
69 0.72
70 0.78