Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9J7X4

Protein Details
Accession W9J7X4    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-66ERLENWHTEHKRRETRRWSYLVMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, plas 5, golg 4, mito 3, cyto 2, pero 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR033379  Acid_Pase_AS  
IPR000560  His_Pase_clade-2  
IPR029033  His_PPase_superfam  
IPR016274  Histidine_acid_Pase_euk  
Gene Ontology GO:0016020  C:membrane  
GO:0016158  F:3-phytase activity  
Pfam View protein in Pfam  
PF00328  His_Phos_2  
PROSITE View protein in PROSITE  
PS00778  HIS_ACID_PHOSPHAT_2  
CDD cd07061  HP_HAP_like  
Amino Acid Sequences MVRIPRDDAPSEANRSDASDADAERGRLLSGNDDEAEESYADAERLENWHTEHKRRETRRWSYLVMVTSTVALITVLAIWVHNNTLSSGCEYDGSCNDISKLWGQYSSFFSVPSEVDSSTPDDCEVTIGIALSRHGARYPTAGKTTAYSATIARLQKSVTNYGKGYEWLSDYEYNLGSEDLTDFGQDQMVDSGKAFYERYIGLAEKTEPFIRASGSDRVIMSSHNFTQGFYASRGESGYDYTDDILVIPEEPGINNTLSHGTCSSFEDNDEVGDNSAQTAWGNKFLPPIRDRLNRNLHKAKLSLQETIYLMDLCPFNIVNTPDGVGQSRFCDLFSIEDWRSYDYYMTLGKYYEYGNGNAMGPTQGVGYVNELVSRLTRKPVDDHTTTNRTLDGNPETFPLDRALYADFSHDNTMVSIFSAMGLYNSTSKLPKHHIVPAIRAHGYSSAWVVPFAARMYVEKLECGATNEEKGEEFVRVLINDRVMEMESCGGDEYGRCKLEDFVESLSFARQGGHWNKCGIKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.31
4 0.25
5 0.22
6 0.19
7 0.2
8 0.23
9 0.25
10 0.23
11 0.22
12 0.21
13 0.18
14 0.17
15 0.17
16 0.19
17 0.18
18 0.21
19 0.21
20 0.21
21 0.21
22 0.2
23 0.21
24 0.14
25 0.12
26 0.1
27 0.1
28 0.09
29 0.09
30 0.08
31 0.08
32 0.11
33 0.13
34 0.14
35 0.16
36 0.27
37 0.33
38 0.41
39 0.49
40 0.57
41 0.65
42 0.71
43 0.79
44 0.8
45 0.83
46 0.84
47 0.81
48 0.74
49 0.69
50 0.66
51 0.58
52 0.49
53 0.4
54 0.31
55 0.26
56 0.22
57 0.16
58 0.11
59 0.07
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.05
67 0.06
68 0.07
69 0.07
70 0.08
71 0.08
72 0.1
73 0.11
74 0.13
75 0.13
76 0.13
77 0.14
78 0.14
79 0.17
80 0.17
81 0.19
82 0.17
83 0.17
84 0.17
85 0.16
86 0.17
87 0.18
88 0.19
89 0.16
90 0.18
91 0.18
92 0.21
93 0.25
94 0.27
95 0.23
96 0.21
97 0.2
98 0.2
99 0.2
100 0.19
101 0.16
102 0.13
103 0.13
104 0.14
105 0.17
106 0.15
107 0.15
108 0.13
109 0.11
110 0.11
111 0.11
112 0.1
113 0.07
114 0.07
115 0.06
116 0.07
117 0.07
118 0.07
119 0.08
120 0.09
121 0.09
122 0.1
123 0.11
124 0.11
125 0.16
126 0.2
127 0.22
128 0.24
129 0.25
130 0.24
131 0.24
132 0.26
133 0.23
134 0.2
135 0.17
136 0.14
137 0.15
138 0.21
139 0.21
140 0.19
141 0.18
142 0.18
143 0.2
144 0.23
145 0.3
146 0.27
147 0.3
148 0.29
149 0.29
150 0.29
151 0.27
152 0.25
153 0.18
154 0.16
155 0.13
156 0.16
157 0.16
158 0.15
159 0.16
160 0.15
161 0.14
162 0.13
163 0.11
164 0.08
165 0.07
166 0.07
167 0.06
168 0.06
169 0.06
170 0.06
171 0.06
172 0.07
173 0.06
174 0.06
175 0.07
176 0.07
177 0.07
178 0.07
179 0.08
180 0.07
181 0.08
182 0.08
183 0.07
184 0.09
185 0.09
186 0.1
187 0.11
188 0.11
189 0.1
190 0.11
191 0.13
192 0.11
193 0.13
194 0.13
195 0.12
196 0.13
197 0.13
198 0.12
199 0.12
200 0.15
201 0.17
202 0.17
203 0.18
204 0.17
205 0.17
206 0.17
207 0.16
208 0.15
209 0.14
210 0.13
211 0.16
212 0.16
213 0.15
214 0.16
215 0.17
216 0.16
217 0.14
218 0.15
219 0.11
220 0.11
221 0.11
222 0.11
223 0.1
224 0.09
225 0.09
226 0.08
227 0.08
228 0.08
229 0.08
230 0.07
231 0.07
232 0.06
233 0.05
234 0.04
235 0.04
236 0.04
237 0.04
238 0.04
239 0.05
240 0.06
241 0.06
242 0.06
243 0.06
244 0.09
245 0.09
246 0.09
247 0.09
248 0.09
249 0.09
250 0.12
251 0.13
252 0.11
253 0.11
254 0.12
255 0.11
256 0.11
257 0.11
258 0.08
259 0.07
260 0.07
261 0.06
262 0.05
263 0.05
264 0.05
265 0.04
266 0.06
267 0.07
268 0.1
269 0.11
270 0.12
271 0.17
272 0.19
273 0.24
274 0.23
275 0.27
276 0.3
277 0.36
278 0.4
279 0.44
280 0.53
281 0.52
282 0.59
283 0.62
284 0.57
285 0.53
286 0.51
287 0.47
288 0.45
289 0.42
290 0.37
291 0.3
292 0.31
293 0.28
294 0.27
295 0.22
296 0.14
297 0.12
298 0.11
299 0.1
300 0.08
301 0.08
302 0.07
303 0.07
304 0.1
305 0.11
306 0.1
307 0.1
308 0.11
309 0.11
310 0.11
311 0.13
312 0.1
313 0.1
314 0.1
315 0.11
316 0.11
317 0.1
318 0.1
319 0.09
320 0.11
321 0.11
322 0.16
323 0.15
324 0.17
325 0.18
326 0.19
327 0.19
328 0.17
329 0.16
330 0.11
331 0.12
332 0.12
333 0.12
334 0.11
335 0.11
336 0.1
337 0.11
338 0.11
339 0.14
340 0.14
341 0.14
342 0.15
343 0.16
344 0.16
345 0.15
346 0.15
347 0.1
348 0.08
349 0.07
350 0.06
351 0.06
352 0.06
353 0.06
354 0.08
355 0.09
356 0.09
357 0.09
358 0.09
359 0.09
360 0.1
361 0.13
362 0.13
363 0.17
364 0.19
365 0.2
366 0.24
367 0.32
368 0.37
369 0.36
370 0.41
371 0.43
372 0.47
373 0.46
374 0.42
375 0.36
376 0.31
377 0.28
378 0.28
379 0.26
380 0.21
381 0.21
382 0.22
383 0.22
384 0.21
385 0.22
386 0.18
387 0.14
388 0.12
389 0.13
390 0.13
391 0.13
392 0.13
393 0.14
394 0.13
395 0.14
396 0.16
397 0.15
398 0.14
399 0.13
400 0.13
401 0.11
402 0.1
403 0.08
404 0.06
405 0.06
406 0.06
407 0.06
408 0.05
409 0.06
410 0.07
411 0.08
412 0.1
413 0.11
414 0.14
415 0.15
416 0.21
417 0.27
418 0.31
419 0.34
420 0.4
421 0.46
422 0.47
423 0.53
424 0.53
425 0.53
426 0.48
427 0.43
428 0.37
429 0.32
430 0.29
431 0.23
432 0.19
433 0.15
434 0.15
435 0.15
436 0.14
437 0.12
438 0.14
439 0.13
440 0.12
441 0.1
442 0.12
443 0.16
444 0.2
445 0.2
446 0.18
447 0.19
448 0.19
449 0.19
450 0.21
451 0.22
452 0.2
453 0.22
454 0.22
455 0.22
456 0.21
457 0.22
458 0.2
459 0.16
460 0.14
461 0.13
462 0.15
463 0.14
464 0.17
465 0.18
466 0.2
467 0.19
468 0.19
469 0.18
470 0.17
471 0.17
472 0.15
473 0.15
474 0.12
475 0.12
476 0.13
477 0.11
478 0.1
479 0.12
480 0.14
481 0.19
482 0.2
483 0.2
484 0.2
485 0.23
486 0.26
487 0.28
488 0.27
489 0.24
490 0.25
491 0.25
492 0.25
493 0.24
494 0.2
495 0.17
496 0.16
497 0.12
498 0.21
499 0.29
500 0.35
501 0.37
502 0.42