Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9IHH2

Protein Details
Accession W9IHH2   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
131-154PALFKWKTIPKRTKEKPIGHIPKKBasic
NLS Segment(s)
PositionSequence
138-166TIPKRTKEKPIGHIPKKPIGGVSIKRKST
174-184MEKGKSKKRKR
Subcellular Location(s) mito 21.5, cyto_mito 12.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025213  Sim4_Fta2  
Pfam View protein in Pfam  
PF13095  FTA2  
Amino Acid Sequences MFRNLRQLHKCGIVVQDLKSQQYYEGQLCDLSHAWAIPYVFGPEGGIRPSWTFASMAAWDLKCFHDMIEEANESALRAEPPLKPSNSVAKRNDERYGSLHPRLGMQRPFLPMLNYDEGGTWDLNYYLSYDPALFKWKTIPKRTKEKPIGHIPKKPIGGVSIKRKSTATEEAQQMEKGKSKKRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.38
4 0.34
5 0.36
6 0.33
7 0.31
8 0.25
9 0.26
10 0.27
11 0.22
12 0.22
13 0.2
14 0.21
15 0.2
16 0.21
17 0.18
18 0.15
19 0.13
20 0.11
21 0.11
22 0.12
23 0.12
24 0.1
25 0.1
26 0.1
27 0.1
28 0.1
29 0.1
30 0.09
31 0.1
32 0.11
33 0.1
34 0.1
35 0.11
36 0.13
37 0.12
38 0.12
39 0.11
40 0.1
41 0.12
42 0.11
43 0.12
44 0.14
45 0.14
46 0.13
47 0.14
48 0.15
49 0.13
50 0.12
51 0.11
52 0.09
53 0.09
54 0.11
55 0.13
56 0.13
57 0.12
58 0.12
59 0.12
60 0.1
61 0.1
62 0.09
63 0.05
64 0.05
65 0.08
66 0.09
67 0.14
68 0.19
69 0.19
70 0.2
71 0.22
72 0.32
73 0.35
74 0.41
75 0.39
76 0.43
77 0.46
78 0.47
79 0.48
80 0.39
81 0.35
82 0.31
83 0.35
84 0.32
85 0.3
86 0.28
87 0.25
88 0.27
89 0.28
90 0.3
91 0.26
92 0.24
93 0.25
94 0.25
95 0.27
96 0.24
97 0.22
98 0.18
99 0.21
100 0.2
101 0.18
102 0.16
103 0.15
104 0.15
105 0.16
106 0.14
107 0.09
108 0.07
109 0.07
110 0.07
111 0.07
112 0.08
113 0.07
114 0.08
115 0.08
116 0.08
117 0.09
118 0.1
119 0.16
120 0.14
121 0.14
122 0.22
123 0.29
124 0.37
125 0.47
126 0.55
127 0.57
128 0.68
129 0.75
130 0.78
131 0.81
132 0.8
133 0.78
134 0.8
135 0.83
136 0.8
137 0.8
138 0.74
139 0.71
140 0.65
141 0.58
142 0.47
143 0.4
144 0.42
145 0.42
146 0.48
147 0.49
148 0.48
149 0.49
150 0.49
151 0.48
152 0.46
153 0.46
154 0.42
155 0.41
156 0.44
157 0.46
158 0.47
159 0.47
160 0.43
161 0.38
162 0.39
163 0.38
164 0.43