Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9I0V3

Protein Details
Accession W9I0V3   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
327-356VTYDMGPPPKKKRGPKPKPLSERKMLRTTPHydrophilic
NLS Segment(s)
PositionSequence
334-369PPKKKRGPKPKPLSERKMLRTTPIVRKEASYSKRKK
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MAASEENDTAVELIEGDEASKVTHSGAVESSKAEPAVPQPSEGAEASKAVQPLQTSQSPRVSQPRVPQSPHVSQSLRTAQRPLAPAQVQHPQMVQHQSPRVAQSPYPQMPHSPYHQVPQSPHPHMPPSPHMAHHPHMGYPHPHQVLHSPYMAHSPHQMPQSPYQMPQSPHPQMTQSPHTHMPQSPHSHMPQPPHHQMLQSPHPHMQQSPRPQMAQSPHPQMSPSPYMAHPHYAPQTGHPPPQSPLFTPQGTPVMTPQESALFTPLATPRFTPTPTPGPQSAAPAPAPSTPTPQSVASTPAAHSIASTPAPSSVAFTPAPESSSRGQVTYDMGPPPKKKRGPKPKPLSERKMLRTTPIVRKEASYSKRKKEEVIMWMLHHRVDRRGEMVPPSTTDAENHFQIPRSTIAGWKKAMLGLGPIPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.07
4 0.07
5 0.07
6 0.08
7 0.08
8 0.08
9 0.08
10 0.11
11 0.11
12 0.12
13 0.15
14 0.17
15 0.18
16 0.19
17 0.21
18 0.2
19 0.2
20 0.18
21 0.16
22 0.19
23 0.26
24 0.25
25 0.24
26 0.23
27 0.23
28 0.26
29 0.25
30 0.22
31 0.14
32 0.15
33 0.16
34 0.18
35 0.18
36 0.15
37 0.16
38 0.15
39 0.19
40 0.23
41 0.27
42 0.28
43 0.33
44 0.4
45 0.41
46 0.45
47 0.5
48 0.5
49 0.49
50 0.55
51 0.6
52 0.59
53 0.61
54 0.64
55 0.62
56 0.65
57 0.63
58 0.59
59 0.5
60 0.45
61 0.49
62 0.51
63 0.48
64 0.42
65 0.42
66 0.39
67 0.43
68 0.44
69 0.38
70 0.37
71 0.33
72 0.33
73 0.34
74 0.38
75 0.34
76 0.32
77 0.31
78 0.25
79 0.29
80 0.33
81 0.31
82 0.3
83 0.33
84 0.35
85 0.36
86 0.38
87 0.37
88 0.33
89 0.32
90 0.32
91 0.38
92 0.38
93 0.39
94 0.36
95 0.35
96 0.36
97 0.38
98 0.36
99 0.35
100 0.32
101 0.35
102 0.38
103 0.39
104 0.38
105 0.43
106 0.47
107 0.44
108 0.46
109 0.43
110 0.43
111 0.42
112 0.44
113 0.4
114 0.38
115 0.36
116 0.34
117 0.37
118 0.37
119 0.37
120 0.37
121 0.33
122 0.28
123 0.27
124 0.29
125 0.27
126 0.27
127 0.32
128 0.28
129 0.28
130 0.27
131 0.3
132 0.32
133 0.31
134 0.28
135 0.2
136 0.19
137 0.24
138 0.24
139 0.2
140 0.19
141 0.19
142 0.22
143 0.25
144 0.28
145 0.25
146 0.3
147 0.36
148 0.33
149 0.33
150 0.33
151 0.35
152 0.33
153 0.35
154 0.38
155 0.35
156 0.35
157 0.34
158 0.32
159 0.3
160 0.34
161 0.37
162 0.3
163 0.31
164 0.33
165 0.33
166 0.34
167 0.33
168 0.32
169 0.32
170 0.36
171 0.34
172 0.34
173 0.35
174 0.37
175 0.38
176 0.41
177 0.41
178 0.42
179 0.43
180 0.43
181 0.42
182 0.37
183 0.37
184 0.36
185 0.37
186 0.33
187 0.32
188 0.32
189 0.32
190 0.32
191 0.31
192 0.32
193 0.31
194 0.36
195 0.4
196 0.39
197 0.38
198 0.37
199 0.4
200 0.37
201 0.37
202 0.34
203 0.33
204 0.32
205 0.32
206 0.32
207 0.28
208 0.29
209 0.25
210 0.21
211 0.17
212 0.17
213 0.2
214 0.2
215 0.23
216 0.18
217 0.19
218 0.19
219 0.2
220 0.2
221 0.19
222 0.26
223 0.26
224 0.29
225 0.27
226 0.27
227 0.25
228 0.3
229 0.29
230 0.23
231 0.26
232 0.27
233 0.26
234 0.25
235 0.25
236 0.23
237 0.22
238 0.21
239 0.17
240 0.18
241 0.17
242 0.17
243 0.15
244 0.14
245 0.14
246 0.14
247 0.14
248 0.09
249 0.09
250 0.12
251 0.14
252 0.13
253 0.13
254 0.14
255 0.15
256 0.18
257 0.19
258 0.18
259 0.21
260 0.27
261 0.29
262 0.33
263 0.31
264 0.32
265 0.32
266 0.35
267 0.31
268 0.26
269 0.24
270 0.2
271 0.21
272 0.18
273 0.21
274 0.17
275 0.21
276 0.2
277 0.21
278 0.23
279 0.22
280 0.22
281 0.2
282 0.23
283 0.19
284 0.19
285 0.17
286 0.18
287 0.18
288 0.16
289 0.15
290 0.13
291 0.13
292 0.13
293 0.13
294 0.1
295 0.1
296 0.11
297 0.11
298 0.13
299 0.11
300 0.14
301 0.14
302 0.14
303 0.16
304 0.15
305 0.17
306 0.15
307 0.18
308 0.16
309 0.23
310 0.23
311 0.21
312 0.21
313 0.2
314 0.23
315 0.23
316 0.24
317 0.21
318 0.25
319 0.31
320 0.37
321 0.44
322 0.51
323 0.56
324 0.62
325 0.7
326 0.77
327 0.82
328 0.86
329 0.89
330 0.9
331 0.93
332 0.94
333 0.91
334 0.89
335 0.88
336 0.84
337 0.82
338 0.73
339 0.66
340 0.65
341 0.65
342 0.65
343 0.64
344 0.6
345 0.51
346 0.53
347 0.54
348 0.55
349 0.54
350 0.55
351 0.56
352 0.62
353 0.7
354 0.7
355 0.68
356 0.68
357 0.68
358 0.65
359 0.64
360 0.57
361 0.51
362 0.53
363 0.5
364 0.43
365 0.39
366 0.33
367 0.31
368 0.33
369 0.34
370 0.33
371 0.35
372 0.37
373 0.39
374 0.4
375 0.36
376 0.33
377 0.35
378 0.33
379 0.31
380 0.29
381 0.29
382 0.29
383 0.29
384 0.29
385 0.27
386 0.27
387 0.28
388 0.29
389 0.26
390 0.25
391 0.24
392 0.29
393 0.35
394 0.38
395 0.39
396 0.38
397 0.37
398 0.35
399 0.35
400 0.28
401 0.25