Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1HDF3

Protein Details
Accession C1HDF3    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-36FNVNEIKKQKQTRSRCQIQHAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG pbl:PAAG_08794  -  
Amino Acid Sequences MISITILKKQYQDIFNVNEIKKQKQTRSRCQIQHAGGLTRQEDQNLIIPSAALVEQSVIQPSEPAVSGPRPHSGASQQCSNCNLPGHKRTRCPQSSHYLSPRRMEYYDNYWASFVRRLKILLSTPGYVTYVAVADPPDDIEGLAGQVQERGDKVVGYAAWVREGTSPAARKWKRNNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.5
4 0.45
5 0.43
6 0.44
7 0.44
8 0.47
9 0.51
10 0.55
11 0.57
12 0.66
13 0.72
14 0.79
15 0.83
16 0.81
17 0.8
18 0.8
19 0.72
20 0.69
21 0.61
22 0.53
23 0.45
24 0.41
25 0.35
26 0.29
27 0.26
28 0.2
29 0.17
30 0.16
31 0.19
32 0.18
33 0.17
34 0.14
35 0.14
36 0.13
37 0.13
38 0.12
39 0.06
40 0.04
41 0.04
42 0.05
43 0.06
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.07
50 0.06
51 0.06
52 0.08
53 0.09
54 0.12
55 0.14
56 0.16
57 0.16
58 0.17
59 0.18
60 0.21
61 0.25
62 0.26
63 0.31
64 0.3
65 0.3
66 0.33
67 0.32
68 0.28
69 0.25
70 0.25
71 0.23
72 0.3
73 0.36
74 0.37
75 0.41
76 0.45
77 0.53
78 0.55
79 0.55
80 0.51
81 0.53
82 0.55
83 0.55
84 0.58
85 0.56
86 0.54
87 0.52
88 0.49
89 0.43
90 0.38
91 0.34
92 0.29
93 0.27
94 0.33
95 0.31
96 0.29
97 0.27
98 0.26
99 0.26
100 0.29
101 0.24
102 0.18
103 0.18
104 0.19
105 0.19
106 0.23
107 0.23
108 0.23
109 0.24
110 0.23
111 0.23
112 0.23
113 0.23
114 0.18
115 0.16
116 0.11
117 0.08
118 0.07
119 0.07
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.06
126 0.06
127 0.05
128 0.05
129 0.06
130 0.06
131 0.06
132 0.06
133 0.07
134 0.08
135 0.09
136 0.09
137 0.11
138 0.1
139 0.1
140 0.11
141 0.12
142 0.12
143 0.14
144 0.17
145 0.16
146 0.18
147 0.18
148 0.19
149 0.17
150 0.19
151 0.2
152 0.24
153 0.27
154 0.29
155 0.4
156 0.43
157 0.5