Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9IDD0

Protein Details
Accession W9IDD0   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
28-56QSPYQHHRYKYRYQHPRSQSPPQRRRGSIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MTVDAVSHHQCPYKSPDYYSEERLADGQSPYQHHRYKYRYQHPRSQSPPQRRRGSIDRNDPGPTERGSTSNGGPLGYSPPGYGPPQLNFNGHQLPACIEDEELIKEYVLSDVSRSASQPAGQDADGPEDLVFGEVHPLFQMYSELSKVANPPYLLSRAFEASLKKPLRIGLLLWML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.43
4 0.46
5 0.5
6 0.52
7 0.49
8 0.41
9 0.39
10 0.38
11 0.31
12 0.27
13 0.23
14 0.21
15 0.2
16 0.24
17 0.28
18 0.35
19 0.39
20 0.4
21 0.48
22 0.52
23 0.58
24 0.64
25 0.7
26 0.72
27 0.75
28 0.8
29 0.79
30 0.82
31 0.79
32 0.79
33 0.78
34 0.78
35 0.81
36 0.8
37 0.8
38 0.73
39 0.73
40 0.72
41 0.72
42 0.7
43 0.71
44 0.65
45 0.6
46 0.59
47 0.53
48 0.45
49 0.37
50 0.29
51 0.21
52 0.18
53 0.16
54 0.18
55 0.19
56 0.17
57 0.18
58 0.17
59 0.14
60 0.13
61 0.13
62 0.13
63 0.11
64 0.11
65 0.08
66 0.08
67 0.1
68 0.11
69 0.12
70 0.12
71 0.12
72 0.16
73 0.17
74 0.18
75 0.17
76 0.19
77 0.19
78 0.17
79 0.16
80 0.13
81 0.12
82 0.13
83 0.13
84 0.1
85 0.08
86 0.08
87 0.09
88 0.1
89 0.1
90 0.08
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.06
97 0.05
98 0.07
99 0.08
100 0.09
101 0.09
102 0.1
103 0.1
104 0.12
105 0.13
106 0.13
107 0.13
108 0.13
109 0.14
110 0.13
111 0.16
112 0.14
113 0.14
114 0.11
115 0.1
116 0.1
117 0.09
118 0.08
119 0.05
120 0.09
121 0.08
122 0.09
123 0.09
124 0.09
125 0.08
126 0.09
127 0.1
128 0.07
129 0.09
130 0.1
131 0.1
132 0.1
133 0.12
134 0.14
135 0.16
136 0.18
137 0.17
138 0.18
139 0.22
140 0.25
141 0.24
142 0.23
143 0.23
144 0.21
145 0.22
146 0.23
147 0.24
148 0.24
149 0.33
150 0.34
151 0.32
152 0.32
153 0.33
154 0.35
155 0.32
156 0.3